|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (5, 7)
|
Asymmetric Unit (5, 5)
|
(no "SS Bond" information available for 1SZD) |
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 1SZD) |
Asymmetric Unit (2, 2)
|
Asymmetric Unit (2, 2) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:291 aligned with HST2_YEAST | P53686 from UniProtKB/Swiss-Prot Length:357 Alignment length:296 1 | 7 17 27 37 47 57 67 77 87 97 107 117 127 137 147 157 167 177 187 197 207 217 227 237 247 257 267 277 287 HST2_YEAST - ---MSVSTASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTSGKHPQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA 293 SCOP domains d1szda_ A: Hst2 SCOP domains CATH domains 1szdA01 A:-2-37,A:94-134,A:190-293 1szdA02 A:38-93,A:135-189 SIR2/SIRT2 'Small Domain' 1szdA01 A:-2-37,A:94-134,A:190-293 1szdA02 A:38-93,A:135-189 SIR2/SIRT2 'Small Domain' 1szdA01 A:-2-37,A:94 -134,A:190-293 TPP-binding domain CATH domains Pfam domains ----------------------------------SIR2-1szdA01 A:32-230 --------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------SIRTUIN PDB: A:13-286 UniProt: 13-286 ------- PROSITE Transcript 2 ---Exon 2.1 PDB: A:1-293 (gaps) UniProt: 1-357 [INCOMPLETE] Transcript 2 1szd A -2 MASMSVSTASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITT-----QQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA 293 7 17 27 37 47 57 67 77 87 97 107 117 127 137 147 157 167 177 187 197 207 | 217 227 237 247 257 267 277 287 209 215 Chain B from PDB Type:PROTEIN Length:8 aligned with H4_YEAST | P02309 from UniProtKB/Swiss-Prot Length:103 Alignment length:8 H4_YEAST 13 KGGAKRHR 20 SCOP domains -------- SCOP domains CATH domains -------- CATH domains Pfam domains -------- Pfam domains SAPs(SNPs) -------- SAPs(SNPs) PROSITE (2) --HISTO- PROSITE (2) Transcript 1 Exon 1.1 Transcript 1 1szd B 12 KGGAkRHR 19 | | 16-ALY
|
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A (HST2_YEAST | P53686)
Chain B (H4_YEAST | P02309)
|
|
|
|
|
|
|