Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE CHIMERIC AF1503 HAMP- ENVZ DHP HOMODIMER
 
Authors :  M. Coles, H. U. Ferris, M. Hulko, J. Martin, A. N. Lupas
Date :  10 Jul 11  (Deposition) - 24 Aug 11  (Release) - 01 Feb 12  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (18x)
NMR Structure *:  A,B  (1x)
Keywords :  Transmembrane Signaling, Hamp Domain, Histidine Kinase, Gearbox Model, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. U. Ferris, S. Dunin-Horkawicz, N. Hornig, M. Hulko, J. Martin, J. E. Schultz, K. Zeth, A. N. Lupas, M. Coles
Mechanism Of Regulation Of Receptor Histidine Kinases.
Structure V. 20 56 2012
PubMed-ID: 22244755  |  Reference-DOI: 10.1016/J.STR.2011.11.014

(-) Compounds

Molecule 1 - UNCHARACTERIZED PROTEIN, OSMOLARITY SENSOR PROTEIN ENVZ CHIMERA
    Chains: A, B
    EC Number: 2.7.13.3
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector: PET30B
    Gene: AF_1503
    Organism Scientific: ARCHAEOGLOBUS FULGIDUS, SHIGELLA FLEXNERI
    Organism Taxid: 224325, 623
    Strain: ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126

 Structural Features

(-) Chains, Units

  12
NMR Structure (18x): AB
NMR Structure * (1x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2LFR)

(-) Sites  (0, 0)

(no "Site" information available for 2LFR)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2LFR)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2LFR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2LFR)

(-) PROSITE Motifs  (2, 4)

NMR Structure (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HAMPPS50885 HAMP domain profile.ENVZ_SHIFL180-232
 		  2A:282-331
B:282-331
2HIS_KINPS50109 Histidine kinase domain profile.ENVZ_SHIFL240-440
 		  2A:339-388
B:339-388
NMR Structure * (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HAMPPS50885 HAMP domain profile.ENVZ_SHIFL180-232
 		  2A:282-331
B:282-331
2HIS_KINPS50109 Histidine kinase domain profile.ENVZ_SHIFL240-440
 		  2A:339-388
B:339-388

(-) Exons   (0, 0)

(no "Exon" information available for 2LFR)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:111
 aligned with ENVZ_SHIFL | P0AEJ5 from UniProtKB/Swiss-Prot  Length:450

    Alignment length:111
                                                         210                                                                               
                                                       209 |                                                                               
                                   189       199       209 |     218       228       238       248       258       268       278       288 
           ENVZ_SHIFL   180 RIQNRPLVDLEHAALQVGKGIIPPPLREYG-ASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR 289
               SCOP domains --------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE HAMP  PDB: A:282-331 UniProt: 180-232                 -------HIS_KIN  PDB: A:339-388 UniProt: 240-440           PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------- Transcript
                 2lfr A 278 STITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR 388
                                   287       297       307       317       327       337       347       357       367       377       387 


Chain A from PDB  Type:PROTEIN  Length:111
 aligned with O28769_ARCFU | O28769 from UniProtKB/TrEMBL  Length:338

    Alignment length:310
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323
         O28769_ARCFU    14 ASLVPLSVLGYLTIAGMTSSAEEAKQGVTTVSQEYLTKAGEEAVRMKAQDLALAVQTYIEAKMKLENKTMLTTFDLIQDPKFRSLGAQRWGAKEYTWVGAGNKVAGRDVAVILTHPAFTGQYEKYLGVDVAMLRWNETMPELYNLLLKITENPEAPKPVCGYYHWDDPETPEKEEIPKYLCHYPTTIKVYDPISKGQLWVVVGTSAYIDGYFQYLTQNPANPAENIASEISKSVEGAIQQVYYALGIAAAIAIVFVIVLAVFTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLR 323
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh-------hhhhhhhhhhhhhh.............hhhhhhhhh----------hhh-hh------------------hhhhhh---hhhhhhhhhh-----------hhh---------------------------------------------------hhhhh------------hhhhhhhhhhhhhh-----------hhh--------------hhhhhhhhhh-----------------------------------------------hhh--------------hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2lfr A 278 STITR-------PIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKS----------IER-LR------------------RSLKQL---ADDRTLLMAG-----------VSH---------------------------------------------------DLRTP------------LTRIRLATEMMSEQ-----------DGY--------------LAESINKDIE-----------------------------------------------ECN--------------AIIEQFIDYLR 388
                                |    -  |    290       300       310       | -       320| ||     -         -  |    | - |     338|        -  | |    -         -         -         -         -      |346|        -   |   354      |  -       363|        -     | 369    |    -         -         -         -         -  | |    -       378       388
                              282     283                                318        319 | ||                324  329 330      339         340 |                                                 343 347          348          361         362 |            365      374                                             375 |            378          
                                                                                      321 ||                                                342                                                                                             364                                                                       377                         
                                                                                        322|                                                                                                                                                                                                                                                      
                                                                                         323                                                                                                                                                                                                                                                      


Chain B from PDB  Type:PROTEIN  Length:111
 aligned with ENVZ_SHIFL | P0AEJ5 from UniProtKB/Swiss-Prot  Length:450

    Alignment length:111
                                                         210                                                                               
                                                       209 |                                                                               
                                   189       199       209 |     218       228       238       248       258       268       278       288 
           ENVZ_SHIFL   180 RIQNRPLVDLEHAALQVGKGIIPPPLREYG-ASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR 289
               SCOP domains --------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE HAMP  PDB: B:282-331 UniProt: 180-232                 -------HIS_KIN  PDB: B:339-388 UniProt: 240-440           PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------- Transcript
                 2lfr B 278 STITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR 388
                                   287       297       307       317       327       337       347       357       367       377       387 


Chain B from PDB  Type:PROTEIN  Length:111
 aligned with O28769_ARCFU | O28769 from UniProtKB/TrEMBL  Length:338

    Alignment length:310
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323
         O28769_ARCFU    14 ASLVPLSVLGYLTIAGMTSSAEEAKQGVTTVSQEYLTKAGEEAVRMKAQDLALAVQTYIEAKMKLENKTMLTTFDLIQDPKFRSLGAQRWGAKEYTWVGAGNKVAGRDVAVILTHPAFTGQYEKYLGVDVAMLRWNETMPELYNLLLKITENPEAPKPVCGYYHWDDPETPEKEEIPKYLCHYPTTIKVYDPISKGQLWVVVGTSAYIDGYFQYLTQNPANPAENIASEISKSVEGAIQQVYYALGIAAAIAIVFVIVLAVFTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLR 323
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh-------hhhhhhhhhhhhhh.............hhhhhhhhh----------hhh-hh------------------hhhhhh---hhhhhhhhhh-----------hhh---------------------------------------------------hhhhh------------hhhhhhhhhhhhhh-----------hhh--------------hhhhhhhhhh-----------------------------------------------hhh--------------hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2lfr B 278 STITR-------PIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKS----------IER-LR------------------RSLKQL---ADDRTLLMAG-----------VSH---------------------------------------------------DLRTP------------LTRIRLATEMMSEQ-----------DGY--------------LAESINKDIE-----------------------------------------------ECN--------------AIIEQFIDYLR 388
                                |    -  |    290       300       310       | -       320| ||     -         -  |    | - |     338|        -  | |    -         -         -         -         -      |346|        -   |   354      |  -       363|        -     | 369    |    -         -         -         -         -  | |    -       378       388
                              282     283                                318        319 | ||                324  329 330      339         340 |                                                 343 347          348          361         362 |            365      374                                             375 |            378          
                                                                                      321 ||                                                342                                                                                             364                                                                       377                         
                                                                                        322|                                                                                                                                                                                                                                                      
                                                                                         323
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2LFR)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2LFR)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2LFR)

(-) Gene Ontology  (18, 22)

NMR Structure(hide GO term definitions)
Chain A,B   (ENVZ_SHIFL | P0AEJ5)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0000155    phosphorelay sensor kinase activity    Catalysis of the phosphorylation of a histidine residue in response to detection of an extracellular signal such as a chemical ligand or change in environment, to initiate a change in cell state or activity. The two-component sensor is a histidine kinase that autophosphorylates a histidine residue in its active site. The phosphate is then transferred to an aspartate residue in a downstream response regulator, to trigger a response.
    GO:0004673    protein histidine kinase activity    Catalysis of the reaction: ATP + protein L-histidine = ADP + protein phospho-L-histidine.
    GO:0004871    signal transducer activity    Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016772    transferase activity, transferring phosphorus-containing groups    Catalysis of the transfer of a phosphorus-containing group from one compound (donor) to another (acceptor).
biological process
    GO:0018106    peptidyl-histidine phosphorylation    The phosphorylation of peptidyl-histidine to form peptidyl-1'-phospho-L-histidine (otherwise known as tau-phosphohistidine, tele-phosphohistidine) or peptidyl-3'-phospho-L-histidine (otherwise known as pi-phosphohistidine, pros-phosphohistidine).
    GO:0000160    phosphorelay signal transduction system    A conserved series of molecular signals found in prokaryotes and eukaryotes; involves autophosphorylation of a histidine kinase and the transfer of the phosphate group to an aspartate that then acts as a phospho-donor to response regulator proteins.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0023014    signal transduction by protein phosphorylation    A process in which the transfer of one or more phosphate groups to a substrate transmits a signal to the phosphorylated substrate.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain A,B   (O28769_ARCFU | O28769)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004871    signal transducer activity    Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
biological process
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2lfr)
 
  Sites
(no "Sites" information available for 2lfr)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2lfr)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2lfr
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ENVZ_SHIFL | P0AEJ5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  O28769_ARCFU | O28769
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.7.13.3
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ENVZ_SHIFL | P0AEJ5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  O28769_ARCFU | O28769
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ENVZ_SHIFL | P0AEJ5: 1bxd 1joy 1njv 2lfs
UniProtKB/TrEMBL
        O28769_ARCFU | O28769: 2l7h 2l7i 2lfs 2y0q 2y0t 2y20 2y21 3zcc 3zrv 3zrw 3zrx 3zx6 4cq4 4cti 4gn0

(-) Related Entries Specified in the PDB File

2lfs
3zrv CRYSTAL STRUCTURE (A291F VARIANT) RELATED ID: 17775 RELATED DB: BMRB
3zrw CRYSTAL STRUCTURE (A291V VARIANT)
3zrx CRYSTAL STRUCTURE