|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 8)
|
Asymmetric Unit (8, 8)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 2HEX) |
(no "SAP(SNP)/Variant" information available for 2HEX) |
Asymmetric Unit (2, 10)
|
(no "Exon" information available for 2HEX) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:56 aligned with BPT1_BOVIN | P00974 from UniProtKB/Swiss-Prot Length:100 Alignment length:56 45 55 65 75 85 BPT1_BOVIN 36 RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCG 91 SCOP domains d2hexa_ A: Pancreatic trypsin inhibitor, BPTI SCOP domains CATH domains 2hexA00 A:1-56 Factor Xa Inhibitor CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE (1) ----BPTI_KUNITZ_2 PDB: A:5-55 UniProt: 40-90 - PROSITE (1) PROSITE (2) --------------------------------BPTI_KUNITZ_1 ----- PROSITE (2) Transcript -------------------------------------------------------- Transcript 2hex A 1 RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCG 56 10 20 30 40 50 Chain B from PDB Type:PROTEIN Length:56 aligned with BPT1_BOVIN | P00974 from UniProtKB/Swiss-Prot Length:100 Alignment length:56 45 55 65 75 85 BPT1_BOVIN 36 RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCG 91 SCOP domains d2hexb_ B: Pancreatic trypsin inhibitor, BPTI SCOP domains CATH domains 2hexB00 B:1-56 Factor Xa Inhibitor CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE (1) ----BPTI_KUNITZ_2 PDB: B:5-55 UniProt: 40-90 - PROSITE (1) PROSITE (2) --------------------------------BPTI_KUNITZ_1 ----- PROSITE (2) Transcript -------------------------------------------------------- Transcript 2hex B 1 RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCG 56 10 20 30 40 50 Chain C from PDB Type:PROTEIN Length:57 aligned with BPT1_BOVIN | P00974 from UniProtKB/Swiss-Prot Length:100 Alignment length:57 45 55 65 75 85 BPT1_BOVIN 36 RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGG 92 SCOP domains d2hexc_ C: Pancreatic trypsin inhibitor, BPTI SCOP domains CATH domains 2hexC00 C:1-57 Factor Xa Inhibitor CATH domains Pfam domains --------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs) PROSITE (1) ----BPTI_KUNITZ_2 PDB: C:5-55 UniProt: 40-90 -- PROSITE (1) PROSITE (2) --------------------------------BPTI_KUNITZ_1 ------ PROSITE (2) Transcript --------------------------------------------------------- Transcript 2hex C 1 RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGG 57 10 20 30 40 50 Chain D from PDB Type:PROTEIN Length:56 aligned with BPT1_BOVIN | P00974 from UniProtKB/Swiss-Prot Length:100 Alignment length:56 45 55 65 75 85 BPT1_BOVIN 36 RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCG 91 SCOP domains d2hexd_ D: Pancreatic trypsin inhibitor, BPTI SCOP domains CATH domains 2hexD00 D:1-56 Factor Xa Inhibitor CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE (1) ----BPTI_KUNITZ_2 PDB: D:5-55 UniProt: 40-90 - PROSITE (1) PROSITE (2) --------------------------------BPTI_KUNITZ_1 ----- PROSITE (2) Transcript -------------------------------------------------------- Transcript 2hex D 1 RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCG 56 10 20 30 40 50 Chain E from PDB Type:PROTEIN Length:56 aligned with BPT1_BOVIN | P00974 from UniProtKB/Swiss-Prot Length:100 Alignment length:56 45 55 65 75 85 BPT1_BOVIN 36 RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCG 91 SCOP domains d2hexe_ E: Pancreatic trypsin inhibitor, BPTI SCOP domains CATH domains 2hexE00 E:1-56 Factor Xa Inhibitor CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE (1) ----BPTI_KUNITZ_2 PDB: E:5-55 UniProt: 40-90 - PROSITE (1) PROSITE (2) --------------------------------BPTI_KUNITZ_1 ----- PROSITE (2) Transcript -------------------------------------------------------- Transcript 2hex E 1 RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCG 56 10 20 30 40 50
|
Asymmetric Unit |
Asymmetric Unit
|
(no "Pfam Domain" information available for 2HEX) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D,E (BPT1_BOVIN | P00974)
|
|
|
|
|
|
|