Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  KETOPIPERAZINE-BASED RENIN INHIBITORS: OPTIMIZATION OF THE "C" RING
 
Authors :  D. D. Holsworth, M. Jalaiea, E. Zhanga, P. Mcconnella
Date :  15 Feb 06  (Deposition) - 13 Jun 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  B  (3x)
Keywords :  Protein-Ligand Complexes, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. D. Holsworth, C. Cai, X. M. Cheng, W. L. Cody, D. M. Downing, N. Erasga, C. Lee, N. A. Powell, J. J. Ednunds, M. Stier, M. Jalaie, E. Zhang, P. Mcconnell, M. J. Ryan, J. Bryant, T. Li, A. Kasani, E. Hall, R. Subedi, M. Rahim, S. Maiti
Ketopiperazine-Based Renin Inhibitors: Optimization Of The "C" Ring
Bioorg. Med. Chem. Lett. V. 16 2500 2006
PubMed-ID: 16480874  |  Reference-DOI: 10.1016/J.BMCL.2006.01.084
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - RENIN
    ChainsA, B
    EC Number3.4.23.15
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneREN
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymANGIOTENSINOGENASE

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B
Biological Unit 3 (3x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
14LG2Ligand/IonMETHYL (6-{[(2R)-1-(4-{3-[(2-METHOXYBENZYL)OXY]PROPOXY}PHENYL)-6-OXOPIPERAZIN-2-YL]METHOXY}-1H-INDOL-1-YL)ACETATE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
14LG1Ligand/IonMETHYL (6-{[(2R)-1-(4-{3-[(2-METHOXYBENZYL)OXY]PROPOXY}PHENYL)-6-OXOPIPERAZIN-2-YL]METHOXY}-1H-INDOL-1-YL)ACETATE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
14LG1Ligand/IonMETHYL (6-{[(2R)-1-(4-{3-[(2-METHOXYBENZYL)OXY]PROPOXY}PHENYL)-6-OXOPIPERAZIN-2-YL]METHOXY}-1H-INDOL-1-YL)ACETATE
Biological Unit 3 (1, 3)
No.NameCountTypeFull Name
14LG3Ligand/IonMETHYL (6-{[(2R)-1-(4-{3-[(2-METHOXYBENZYL)OXY]PROPOXY}PHENYL)-6-OXOPIPERAZIN-2-YL]METHOXY}-1H-INDOL-1-YL)ACETATE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETHR B:13 , GLN B:14 , TYR B:15 , ASP B:33 , SER B:36 , TRP B:40 , PRO B:42 , HIS B:56 , VAL B:106 , MET B:109 , PRO B:113 , PHE B:114 , ALA B:117 , PHE B:119 , ASP B:120 , VAL B:122 , ASP B:219 , GLY B:221 , ALA B:222 , SER B:223BINDING SITE FOR RESIDUE 4LG B 803
2AC2SOFTWARETHR A:13 , GLN A:14 , ASP A:33 , GLY A:35 , TRP A:40 , PRO A:42 , HIS A:56 , VAL A:83 , VAL A:106 , MET A:109 , PHE A:114 , ALA A:117 , PHE A:119 , ASP A:120 , GLY A:121 , VAL A:122 , ASP A:219 , GLY A:221 , ALA A:222 , SER A:223BINDING SITE FOR RESIDUE 4LG A 804

(-) SS Bonds  (6, 6)

Asymmetric Unit
No.Residues
1A:46 -A:53
2A:210 -A:214
3A:252 -A:289
4B:46 -B:53
5B:210 -B:214
6B:252 -B:289

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1Thr A:23 -Pro A:24
2Leu A:112 -Pro A:113
3Pro A:300 -Pro A:301
4Gly A:303 -Pro A:304
5Thr B:23 -Pro B:24
6Leu B:112 -Pro B:113
7Pro B:300 -Pro B:301
8Gly B:303 -Pro B:304

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (4, 8)

Asymmetric Unit (4, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_035088D104NRENI_HUMANDisease (RTD)868694193A/BD33N
2UniProtVAR_029171Q160KRENI_HUMANPolymorphism11571083A/BQ89K
3UniProtVAR_020376G217RRENI_HUMANPolymorphism11571117A/BG146R
4UniProtVAR_035087R230KRENI_HUMANDisease (RTD)121917742A/BR159K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_035088D104NRENI_HUMANDisease (RTD)868694193AD33N
2UniProtVAR_029171Q160KRENI_HUMANPolymorphism11571083AQ89K
3UniProtVAR_020376G217RRENI_HUMANPolymorphism11571117AG146R
4UniProtVAR_035087R230KRENI_HUMANDisease (RTD)121917742AR159K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_035088D104NRENI_HUMANDisease (RTD)868694193BD33N
2UniProtVAR_029171Q160KRENI_HUMANPolymorphism11571083BQ89K
3UniProtVAR_020376G217RRENI_HUMANPolymorphism11571117BG146R
4UniProtVAR_035087R230KRENI_HUMANDisease (RTD)121917742BR159K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (4, 12)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_035088D104NRENI_HUMANDisease (RTD)868694193BD33N
2UniProtVAR_029171Q160KRENI_HUMANPolymorphism11571083BQ89K
3UniProtVAR_020376G217RRENI_HUMANPolymorphism11571117BG146R
4UniProtVAR_035087R230KRENI_HUMANDisease (RTD)121917742BR159K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 6)

Asymmetric Unit (2, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PEPTIDASE_A1PS51767 Peptidase family A1 domain profile.RENI_HUMAN86-403
 
  2A:15-330
B:15-330
2ASP_PROTEASEPS00141 Eukaryotic and viral aspartyl proteases active site.RENI_HUMAN101-112
 
289-300
 
  4A:30-41
B:30-41
A:216-227
B:216-227
Biological Unit 1 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PEPTIDASE_A1PS51767 Peptidase family A1 domain profile.RENI_HUMAN86-403
 
  1A:15-330
-
2ASP_PROTEASEPS00141 Eukaryotic and viral aspartyl proteases active site.RENI_HUMAN101-112
 
289-300
 
  2A:30-41
-
A:216-227
-
Biological Unit 2 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PEPTIDASE_A1PS51767 Peptidase family A1 domain profile.RENI_HUMAN86-403
 
  1-
B:15-330
2ASP_PROTEASEPS00141 Eukaryotic and viral aspartyl proteases active site.RENI_HUMAN101-112
 
289-300
 
  2-
B:30-41
-
B:216-227
Biological Unit 3 (2, 9)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PEPTIDASE_A1PS51767 Peptidase family A1 domain profile.RENI_HUMAN86-403
 
  3-
B:15-330
2ASP_PROTEASEPS00141 Eukaryotic and viral aspartyl proteases active site.RENI_HUMAN101-112
 
289-300
 
  6-
B:30-41
-
B:216-227

(-) Exons   (9, 18)

Asymmetric Unit (9, 18)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000002721901bENSE00001952423chr1:204135450-204135324127RENI_HUMAN1-33330--
1.2ENST000002721902ENSE00000962217chr1:204131291-204131141151RENI_HUMAN33-83512A:3-12
B:3-12
10
10
1.3ENST000002721903ENSE00000962218chr1:204130543-204130420124RENI_HUMAN84-125422A:13-54
B:13-54
42
42
1.4ENST000002721904ENSE00001075102chr1:204129806-204129688119RENI_HUMAN125-164402A:54-93
B:54-93
40
40
1.5ENST000002721905ENSE00001075100chr1:204128723-204128527197RENI_HUMAN165-230662A:94-159
B:94-159
66
66
1.6ENST000002721906ENSE00001652153chr1:204126497-2041264899RENI_HUMAN230-23342A:159-161
B:159-161
3
3
1.7ENST000002721907ENSE00000962221chr1:204125924-204125805120RENI_HUMAN233-273412A:165-200
B:165-200
36
36
1.8ENST000002721908ENSE00001306111chr1:204125447-204125306142RENI_HUMAN273-320482A:200-247
B:200-247
48
48
1.9ENST000002721909ENSE00000962223chr1:204125046-20412494899RENI_HUMAN321-353332A:248-280
B:248-280
33
33
1.10aENST0000027219010aENSE00001947658chr1:204124305-204123947359RENI_HUMAN354-406532A:281-333
B:281-333
53
53

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:328
 aligned with RENI_HUMAN | P00797 from UniProtKB/Swiss-Prot  Length:406

    Alignment length:333
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403   
           RENI_HUMAN    74 SSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR 406
               SCOP domains d2g27a_ A: Chymosin (synonym: renin)                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 2g27A01 A:3-174 Acid Proteases                                                                                                                                                2g27A02 A:175-332 Acid Proteases                                                                                                                              - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee...eeeeeeee....eeeeeeee.....eeee.................hhhhh...eeeeeeee........eeeeeeeeeee..eeeeeeeeeeee....hhhhh...eeee..hhhhhhhhh.hhhhhhhhh......eeeeee....-----..eeeee...hhhhheeeeeeee.......eeeeeeee............eee.......ee.hhhhhhhhhhh..........eee.hhh.....eeeee..eeeeehhhhhh.........eee..ee...........ee.hhhhhhheeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------N-------------------------------------------------------K--------------------------------------------------------R------------K-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------PEPTIDASE_A1  PDB: A:15-330 UniProt: 86-403                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) ---------------------------ASP_PROTEASE--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE---------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  Exon 1.3  PDB: A:13-54 UniProt: 84-125    ---------------------------------------Exon 1.5  PDB: A:94-159 UniProt: 165-230                          --Exon 1.7  PDB: A:165-200 UniProt: 233-273-----------------------------------------------Exon 1.9  PDB: A:248-280         Exon 1.10a  PDB: A:281-333 UniProt: 354-406           Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------Exon 1.4  PDB: A:54-93 UniProt: 125-164 -----------------------------------------------------------------1.6 ---------------------------------------Exon 1.8  PDB: A:200-247 UniProt: 273-320       -------------------------------------------------------------------------------------- Transcript 1 (2)
                 2g27 A   3 SSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDS-----LGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR 333
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152        |-    |  170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330   
                                                                                                                                                                                        161   165                                                                                                                                                                        

Chain B from PDB  Type:PROTEIN  Length:328
 aligned with RENI_HUMAN | P00797 from UniProtKB/Swiss-Prot  Length:406

    Alignment length:333
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403   
           RENI_HUMAN    74 SSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR 406
               SCOP domains d2g27b_ B: Chymosin (synonym: renin)                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 2g27B01 B:3-174 Acid Proteases                                                                                                                                                2g27B02 B:175-332 Acid Proteases                                                                                                                              - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee...eeeeeeee....eeeeeeee.....eeee.......hhhhh.....hhhhh........eee........eee..eeeeee..eeeeee.eeeee............eeee..hhhhhhhhh.hhhhhhhh.......eeeeee....-----..eeeee...hhhhh....eeee.......eeee..eee..........eeeee.........hhhhhhhhhhhhh.ee....eeee..hhhhh..eeeee..eeeeehhhhhh.........eee................eehhhhhhheeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------N-------------------------------------------------------K--------------------------------------------------------R------------K-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------PEPTIDASE_A1  PDB: B:15-330 UniProt: 86-403                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) ---------------------------ASP_PROTEASE--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE---------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2  Exon 1.3  PDB: B:13-54 UniProt: 84-125    ---------------------------------------Exon 1.5  PDB: B:94-159 UniProt: 165-230                          --Exon 1.7  PDB: B:165-200 UniProt: 233-273-----------------------------------------------Exon 1.9  PDB: B:248-280         Exon 1.10a  PDB: B:281-333 UniProt: 354-406           Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------Exon 1.4  PDB: B:54-93 UniProt: 125-164 -----------------------------------------------------------------1.6 ---------------------------------------Exon 1.8  PDB: B:200-247 UniProt: 273-320       -------------------------------------------------------------------------------------- Transcript 1 (2)
                 2g27 B   3 SSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDS-----LGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR 333
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152        |-    |  170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330   
                                                                                                                                                                                        161   165                                                                                                                                                                        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2G27)

(-) Gene Ontology  (34, 34)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (RENI_HUMAN | P00797)
molecular function
    GO:0004190    aspartic-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which a water molecule bound by the side chains of aspartic residues at the active center acts as a nucleophile.
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0005159    insulin-like growth factor receptor binding    Interacting selectively and non-covalently with the insulin-like growth factor receptor.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
biological process
    GO:0050435    amyloid-beta metabolic process    The chemical reactions and pathways involving amyloid-beta, a glycoprotein associated with Alzheimer's disease, and its precursor, amyloid precursor protein (APP).
    GO:0002003    angiotensin maturation    The process leading to the attainment of the full functional capacity of angiotensin by conversion of renin substrate into mature angiotensin in the blood.
    GO:0048469    cell maturation    A developmental process, independent of morphogenetic (shape) change, that is required for a cell to attain its fully functional state.
    GO:0035690    cellular response to drug    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0042756    drinking behavior    The specific behavior of an organism relating to the intake of liquids, especially water.
    GO:0009755    hormone-mediated signaling pathway    A series of molecular signals mediated by the detection of a hormone.
    GO:0001822    kidney development    The process whose specific outcome is the progression of the kidney over time, from its formation to the mature structure. The kidney is an organ that filters the blood and/or excretes the end products of body metabolism in the form of urine.
    GO:0008584    male gonad development    The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
    GO:0001823    mesonephros development    The process whose specific outcome is the progression of the mesonephros over time, from its formation to the mature structure. In mammals, the mesonephros is the second of the three embryonic kidneys to be established and exists only transiently. In lower vertebrates such as fish and amphibia, the mesonephros will form the mature kidney.
    GO:0030163    protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0043408    regulation of MAPK cascade    Any process that modulates the frequency, rate or extent of signal transduction mediated by the MAP kinase (MAPK) cascade.
    GO:0008217    regulation of blood pressure    Any process that modulates the force with which blood travels through the circulatory system. The process is controlled by a balance of processes that increase pressure and decrease pressure.
    GO:0002016    regulation of blood volume by renin-angiotensin    The process in which the renin-angiotensin system controls the rate of fluid intake and output into the blood.
    GO:0002018    renin-angiotensin regulation of aldosterone production    The process in which an increase in active angiotensin stimulates the adrenal cortices to secrete aldosterone.
    GO:0051591    response to cAMP    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
    GO:0070305    response to cGMP    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cGMP (cyclic GMP, guanosine 3',5'-cyclophosphate) stimulus.
    GO:0042493    response to drug    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0035902    response to immobilization stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of being rendered immobile.
    GO:0032496    response to lipopolysaccharide    Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
    GO:0010033    response to organic substance    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0005764    lysosome    A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    4LG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:303 - Pro A:304   [ RasMol ]  
    Gly B:303 - Pro B:304   [ RasMol ]  
    Leu A:112 - Pro A:113   [ RasMol ]  
    Leu B:112 - Pro B:113   [ RasMol ]  
    Pro A:300 - Pro A:301   [ RasMol ]  
    Pro B:300 - Pro B:301   [ RasMol ]  
    Thr A:23 - Pro A:24   [ RasMol ]  
    Thr B:23 - Pro B:24   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2g27
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RENI_HUMAN | P00797
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.23.15
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  267430
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RENI_HUMAN | P00797
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RENI_HUMAN | P007971bbs 1bil 1bim 1hrn 1rne 2bks 2bkt 2fs4 2g1n 2g1o 2g1r 2g1s 2g1y 2g20 2g21 2g22 2g24 2g26 2i4q 2iko 2iku 2il2 2ren 2v0z 2v10 2v11 2v12 2v13 2v16 2x0b 3d91 3g6z 3g70 3g72 3gw5 3k1w 3km4 3o9l 3oad 3oag 3oot 3oqf 3oqk 3own 3q3t 3q4b 3q5h 3sfc 3vcm 3vsw 3vsx 3vuc 3vyd 3vye 3vyf 4amt 4gj5 4gj6 4gj7 4gj8 4gj9 4gja 4gjb 4gjc 4gjd 4pyv 4q1n 4ryc 4ryg 4rz1 4s1g 4xx3 4xx4 5koq 5kos 5kot 5sxn 5sy2 5sy3 5sz9 5t4s

(-) Related Entries Specified in the PDB File

2g1n 2g1o 2g1r 2g1s 2g1y 2g20 2g21 2g22 2g24 2g26