Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  MINERALOCORTICOID RECEPTOR WITH BOUND ALDOSTERONE
 
Authors :  R. K. Bledsoe, K. P. Madauss, J. A. Holt, C. J. Apolito, M. H. Lambert, K. H T. B. Stanley, E. L. Stewart, R. P. Trump, T. M. Willson, S. P. Williams
Date :  13 Jul 05  (Deposition) - 26 Jul 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.95
Chains :  Asym./Biol. Unit :  A
Keywords :  Mineralocorticoid, Mr, Nuclear Receptor, Steroid Receptor, Aldosterone, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. K. Bledsoe, K. P. Madauss, J. A. Holt, C. J. Apolito, M. H. Lambert, K. H. Pearce, T. B. Stanley, E. L. Stewart, R. P. Trump, T. M. Willson, S. P. Williams
A Ligand-Mediated Hydrogen Bond Network Required For The Activation Of The Mineralocorticoid Receptor
J. Biol. Chem. V. 280 31283 2005
PubMed-ID: 15967794  |  Reference-DOI: 10.1074/JBC.M504098200

(-) Compounds

Molecule 1 - MINERALOCORTICOID RECEPTOR
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21[DE3]
    Expression System Taxid562
    Expression System Vector TypeT7
    GeneNR3C2, MCR, MLR
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMR

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 5)

Asymmetric/Biological Unit (4, 5)
No.NameCountTypeFull Name
1AS41Ligand/IonALDOSTERONE
2BOG1Ligand/IonB-OCTYLGLUCOSIDE
3GOL2Ligand/IonGLYCEROL
4SO41Ligand/IonSULFATE ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHOH A:101 , ALA A:762 , ALA A:844 , TYR A:846 , GLU A:940 , PHE A:941BINDING SITE FOR RESIDUE BOG A 985
2AC2SOFTWAREILE A:749 , TRP A:816 , LYS A:820 , HIS A:821BINDING SITE FOR RESIDUE SO4 A 202
3AC3SOFTWAREHOH A:26 , LEU A:769 , ASN A:770 , ALA A:773 , GLN A:776 , SER A:810 , ARG A:817 , PHE A:829 , MET A:845 , PHE A:941 , CYS A:942 , THR A:945 , VAL A:954 , PHE A:956BINDING SITE FOR RESIDUE AS4 A 201
4AC4SOFTWAREHOH A:115 , HOH A:129 , ILE A:745 , PRO A:747 , GLN A:779 , TRP A:783 , VAL A:786BINDING SITE FOR RESIDUE GOL A 203
5AC5SOFTWAREHOH A:26 , HOH A:31 , HOH A:62 , HOH A:65 , HOH A:68 , HOH A:123 , PRO A:747 , GLN A:776 , ARG A:817 , LYS A:873BINDING SITE FOR RESIDUE GOL A 204

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2AA2)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2AA2)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (12, 12)

Asymmetric/Biological Unit (12, 12)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_031271P759SMCR_HUMANDisease (PHA1A)  ---AP759S
02UniProtVAR_031272L769PMCR_HUMANDisease (PHA1A)  ---AL769P
03UniProtVAR_031273N770KMCR_HUMANDisease (PHA1A)  ---AN770K
04UniProtVAR_031274Q776RMCR_HUMANDisease (PHA1A)  ---AQ776R
05UniProtVAR_031275S805PMCR_HUMANDisease (PHA1A)  ---AS805P
06UniProtVAR_015626S810LMCR_HUMANDisease (EOHSEP)41511344AS810L
07UniProtVAR_031276S815RMCR_HUMANDisease (PHA1A)  ---AS815R
08UniProtVAR_031277S818LMCR_HUMANDisease (PHA1A)  ---AS818L
09UniProtVAR_029311F826YMCR_HUMANPolymorphism13306592AF826Y
10UniProtVAR_015627L924PMCR_HUMANDisease (PHA1A)  ---AL924P
11UniProtVAR_031278E972GMCR_HUMANDisease (PHA1A)  ---AE972G
12UniProtVAR_031279L979PMCR_HUMANDisease (PHA1A)  ---AL979P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2AA2)

(-) Exons   (5, 5)

Asymmetric/Biological Unit (5, 5)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003447211ENSE00002066715chr4:149365850-149365678173MCR_HUMAN-00--
1.3aENST000003447213aENSE00001221601chr4:149358014-1493562561759MCR_HUMAN1-5865860--
1.5aENST000003447215aENSE00001221249chr4:149181269-149181130140MCR_HUMAN586-633480--
1.7bENST000003447217bENSE00001641416chr4:149116013-149115897117MCR_HUMAN633-672400--
1.8aENST000003447218aENSE00001221232chr4:149076052-149075702351MCR_HUMAN672-7891181A:727-78963
1.9aENST000003447219aENSE00001000702chr4:149073764-149073620145MCR_HUMAN789-837491A:789-83749
1.11ENST0000034472111ENSE00001771423chr4:149041439-149041309131MCR_HUMAN837-881451A:837-88145
1.12ENST0000034472112ENSE00001739163chr4:149035412-149035255158MCR_HUMAN881-933531A:881-933 (gaps)53
1.13fENST0000034472113fENSE00002059455chr4:149002650-1489999132738MCR_HUMAN934-984511A:934-98350

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:252
 aligned with MCR_HUMAN | P08235 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:257
                                   736       746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896       906       916       926       936       946       956       966       976       
            MCR_HUMAN   727 LSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFHR 983
               SCOP domains d2aa2a_ A: automated matches                                                                                                                                                                                                                                      SCOP domains
               CATH domains 2aa2A00 A:727-983 Retinoid X Receptor                                                                                                                                                                                                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh.hhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeehhhhhhhh.hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.eee.....hhhhhhhhhhhhhhhhhhhhh-----..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..eee..... Sec.struct. author
                 SAPs(SNPs) --------------------------------S---------PK-----R----------------------------P----L----R--L-------Y-------------------------------------------------------------------------------------------------P-----------------------------------------------G------P---- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8a  PDB: A:727-789 UniProt: 672-789 [INCOMPLETE]        -----------------------------------------------Exon 1.11  PDB: A:837-881 UniProt: 837-881   ----------------------------------------------------Exon 1.13f  PDB: A:934-983 UniProt: 934-984        Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------Exon 1.9a  PDB: A:789-837 UniProt: 789-837       -------------------------------------------Exon 1.12  PDB: A:881-933 (gaps) UniProt: 881-933    -------------------------------------------------- Transcript 1 (2)
                 2aa2 A 727 LSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMSLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVT-----SGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFHR 983
                                   736       746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896       906 |     916       926       936       946       956       966       976       
                                                                                                                                                                                                               908   914                                                                     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2AA2)

(-) Gene Ontology  (21, 21)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (MCR_HUMAN | P08235)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
    GO:0005496    steroid binding    Interacting selectively and non-covalently with a steroid, any of a large group of substances that have in common a ring system based on 1,2-cyclopentanoperhydrophenanthrene.
    GO:0003707    steroid hormone receptor activity    Combining with a steroid hormone and transmitting the signal within the cell to initiate a change in cell activity or function.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0043401    steroid hormone mediated signaling pathway    A series of molecular signals mediated by a steroid hormone binding to a receptor.
    GO:0006367    transcription initiation from RNA polymerase II promoter    Any process involved in the assembly of the RNA polymerase II preinitiation complex (PIC) at an RNA polymerase II promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    AS4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    BOG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2aa2)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2aa2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MCR_HUMAN | P08235
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  177735
    Disease InformationOMIM
  605115
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MCR_HUMAN | P08235
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MCR_HUMAN | P082351y9r 1ya3 2a3i 2aa5 2aa6 2aa7 2aax 2ab2 2abi 2oax 3vhu 3vhv 3wff 3wfg 4pf3 4tnt 4uda 4udb 5hcv 5l7e 5l7g 5l7h

(-) Related Entries Specified in the PDB File

2aa5 2aa6 2aa7