Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  MINERALOCORTICOID RECEPTOR LIGAND-BINDING DOMAIN WITH COMPUOND 37A
 
Authors :  S. Sogabe, N. Habuka
Date :  28 Apr 14  (Deposition) - 26 Nov 14  (Release) - 26 Nov 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.10
Chains :  Asym./Biol. Unit :  A
Keywords :  Nuclear Receptor, Transcription Factor, Hypertension, Non-Steroidal Antagonist, Activating Mutation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Hasui, N. Ohyabu, T. Ohra, K. Fuji, T. Sugimoto, J. Fujimoto, K. Asano, M. Oosawa, S. Shiotani, N. Nishigaki, K. Kusumoto, H. Matsui A. Mizukami, N. Habuka, S. Sogabe, S. Endo, M. Ono, C. S. Siedem, T. P. Tang, C. Gauthier, L. A. De Meese, S. A. Boyd, S. Fukumoto
Discovery Of 6-[5-(4-Fluorophenyl) -3-Methyl-Pyrazol-4-Yl]-Benzoxazin-3-One Derivatives As Novel Selective Nonsteroidal Mineralocorticoid Receptor Antagonists
Bioorg. Med. Chem. V. 22 5428 2014
PubMed-ID: 25187277  |  Reference-DOI: 10.1016/J.BMC.2014.07.038

(-) Compounds

Molecule 1 - MINERALOCORTICOID RECEPTOR
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 716-988
    Gene: NR3C2, MCR, MLR
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: MR,NUCLEAR RECEPTOR SUBFAMILY 3 GROUP C MEMBER 2

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 9)

Asymmetric/Biological Unit (2, 9)
No.NameCountTypeFull Name
1EDO8Ligand/Ion1,2-ETHANEDIOL
2HFN1Ligand/Ion6-[1-(2,2-DIFLUORO-3-HYDROXYPROPYL)-5-(4-FLUOROPHENYL)-3-METHYL-1H-PYRAZOL-4-YL]-2H-1,4-BENZOXAZIN-3(4H)-ONE

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:770 , ALA A:773 , GLN A:776 , MET A:807 , LEU A:810 , SER A:811 , LEU A:814 , ARG A:817 , PHE A:829 , MET A:845 , CYS A:849 , MET A:852 , LEU A:938 , PHE A:941 , CYS A:942 , THR A:945 , VAL A:954binding site for residue HFN A 1001
2AC2SOFTWAREALA A:752 , ARG A:771 , LEU A:772 , ASP A:884 , HOH A:1111 , HOH A:1119binding site for residue EDO A 1002
3AC3SOFTWAREGLN A:889 , SER A:949 , HIS A:950 , LYS A:953 , VAL A:954 , HOH A:1121 , HOH A:1282binding site for residue EDO A 1003
4AC4SOFTWARETYR A:899 , GLU A:902 , HOH A:1188 , HOH A:1293binding site for residue EDO A 1004
5AC5SOFTWAREALA A:844 , MET A:845 , GLU A:847 , LEU A:848 , HOH A:1140binding site for residue EDO A 1005
6AC6SOFTWAREILE A:745 , TRP A:783 , HOH A:1193 , HOH A:1258binding site for residue EDO A 1006
7AC7SOFTWAREASP A:832 , LEU A:833 , VAL A:834 , LYS A:839 , HOH A:1218binding site for residue EDO A 1007
8AC8SOFTWARESER A:808 , THR A:880 , HIS A:932 , VAL A:935 , HOH A:1194binding site for residue EDO A 1008
9AC9SOFTWAREILE A:799 , GLN A:803 , ILE A:963 , HOH A:1102binding site for residue EDO A 1009

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4PF3)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4PF3)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4PF3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4PF3)

(-) Exons   (0, 0)

(no "Exon" information available for 4PF3)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:249
                                                                                                                                                                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeehhhhhhhh.hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.ee......hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh...ee..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4pf3 A 735 TPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMSLLSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNVKPLYFHR 983
                                   744       754       764       774       784       794       804       814       824       834       844       854       864       874       884       894       904       914       924       934       944       954       964       974
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4PF3)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4PF3)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4PF3)

(-) Gene Ontology  (21, 21)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HFN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4pf3)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4pf3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MCR_HUMAN | P08235
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MCR_HUMAN | P08235
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MCR_HUMAN | P08235: 1y9r 1ya3 2a3i 2aa2 2aa5 2aa6 2aa7 2aax 2ab2 2abi 2oax 3vhu 3vhv 3wff 3wfg 4tnt 4uda 4udb 5hcv 5l7e 5l7g 5l7h

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4PF3)