2OAX - JenaLib

Asymmetric Unit (12, 68)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_031271	P	759	S	MCR_HUMAN	Disease (PHA1A)	---	B/E	P	759	S
02	UniProt	VAR_031272	L	769	P	MCR_HUMAN	Disease (PHA1A)	---	A/B/C/D/E/F	L	769	P
03	UniProt	VAR_031273	N	770	K	MCR_HUMAN	Disease (PHA1A)	---	A/B/C/D/E/F	N	770	K
04	UniProt	VAR_031274	Q	776	R	MCR_HUMAN	Disease (PHA1A)	---	A/B/C/D/E/F	Q	776	R
05	UniProt	VAR_031275	S	805	P	MCR_HUMAN	Disease (PHA1A)	---	A/B/C/D/E/F	S	805	P
06	UniProt	VAR_015626	S	810	L	MCR_HUMAN	Disease (EOHSEP)	41511344	A/B/C/D/E/F	L	810	L
07	UniProt	VAR_031276	S	815	R	MCR_HUMAN	Disease (PHA1A)	---	A/B/C/D/E/F	S	815	R
08	UniProt	VAR_031277	S	818	L	MCR_HUMAN	Disease (PHA1A)	---	A/B/C/D/E/F	S	818	L
09	UniProt	VAR_029311	F	826	Y	MCR_HUMAN	Polymorphism	13306592	A/B/C/D/E/F	F	826	Y
10	UniProt	VAR_015627	L	924	P	MCR_HUMAN	Disease (PHA1A)	---	A/B/C/D/E/F	L	924	P
11	UniProt	VAR_031278	E	972	G	MCR_HUMAN	Disease (PHA1A)	---	A/B/C/D/E/F	E	972	G
12	UniProt	VAR_031279	L	979	P	MCR_HUMAN	Disease (PHA1A)	---	A/B/C/D/E/F	L	979	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (11, 11)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
02	UniProt	VAR_031272	L	769	P	MCR_HUMAN	Disease (PHA1A)	---	A	L	769	P
03	UniProt	VAR_031273	N	770	K	MCR_HUMAN	Disease (PHA1A)	---	A	N	770	K
04	UniProt	VAR_031274	Q	776	R	MCR_HUMAN	Disease (PHA1A)	---	A	Q	776	R
05	UniProt	VAR_031275	S	805	P	MCR_HUMAN	Disease (PHA1A)	---	A	S	805	P
06	UniProt	VAR_015626	S	810	L	MCR_HUMAN	Disease (EOHSEP)	41511344	A	L	810	L
07	UniProt	VAR_031276	S	815	R	MCR_HUMAN	Disease (PHA1A)	---	A	S	815	R
08	UniProt	VAR_031277	S	818	L	MCR_HUMAN	Disease (PHA1A)	---	A	S	818	L
09	UniProt	VAR_029311	F	826	Y	MCR_HUMAN	Polymorphism	13306592	A	F	826	Y
10	UniProt	VAR_015627	L	924	P	MCR_HUMAN	Disease (PHA1A)	---	A	L	924	P
11	UniProt	VAR_031278	E	972	G	MCR_HUMAN	Disease (PHA1A)	---	A	E	972	G
12	UniProt	VAR_031279	L	979	P	MCR_HUMAN	Disease (PHA1A)	---	A	L	979	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (12, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_031271	P	759	S	MCR_HUMAN	Disease (PHA1A)	---	B	P	759	S
02	UniProt	VAR_031272	L	769	P	MCR_HUMAN	Disease (PHA1A)	---	B	L	769	P
03	UniProt	VAR_031273	N	770	K	MCR_HUMAN	Disease (PHA1A)	---	B	N	770	K
04	UniProt	VAR_031274	Q	776	R	MCR_HUMAN	Disease (PHA1A)	---	B	Q	776	R
05	UniProt	VAR_031275	S	805	P	MCR_HUMAN	Disease (PHA1A)	---	B	S	805	P
06	UniProt	VAR_015626	S	810	L	MCR_HUMAN	Disease (EOHSEP)	41511344	B	L	810	L
07	UniProt	VAR_031276	S	815	R	MCR_HUMAN	Disease (PHA1A)	---	B	S	815	R
08	UniProt	VAR_031277	S	818	L	MCR_HUMAN	Disease (PHA1A)	---	B	S	818	L
09	UniProt	VAR_029311	F	826	Y	MCR_HUMAN	Polymorphism	13306592	B	F	826	Y
10	UniProt	VAR_015627	L	924	P	MCR_HUMAN	Disease (PHA1A)	---	B	L	924	P
11	UniProt	VAR_031278	E	972	G	MCR_HUMAN	Disease (PHA1A)	---	B	E	972	G
12	UniProt	VAR_031279	L	979	P	MCR_HUMAN	Disease (PHA1A)	---	B	L	979	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (11, 11)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
02	UniProt	VAR_031272	L	769	P	MCR_HUMAN	Disease (PHA1A)	---	C	L	769	P
03	UniProt	VAR_031273	N	770	K	MCR_HUMAN	Disease (PHA1A)	---	C	N	770	K
04	UniProt	VAR_031274	Q	776	R	MCR_HUMAN	Disease (PHA1A)	---	C	Q	776	R
05	UniProt	VAR_031275	S	805	P	MCR_HUMAN	Disease (PHA1A)	---	C	S	805	P
06	UniProt	VAR_015626	S	810	L	MCR_HUMAN	Disease (EOHSEP)	41511344	C	L	810	L
07	UniProt	VAR_031276	S	815	R	MCR_HUMAN	Disease (PHA1A)	---	C	S	815	R
08	UniProt	VAR_031277	S	818	L	MCR_HUMAN	Disease (PHA1A)	---	C	S	818	L
09	UniProt	VAR_029311	F	826	Y	MCR_HUMAN	Polymorphism	13306592	C	F	826	Y
10	UniProt	VAR_015627	L	924	P	MCR_HUMAN	Disease (PHA1A)	---	C	L	924	P
11	UniProt	VAR_031278	E	972	G	MCR_HUMAN	Disease (PHA1A)	---	C	E	972	G
12	UniProt	VAR_031279	L	979	P	MCR_HUMAN	Disease (PHA1A)	---	C	L	979	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (11, 11)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
02	UniProt	VAR_031272	L	769	P	MCR_HUMAN	Disease (PHA1A)	---	D	L	769	P
03	UniProt	VAR_031273	N	770	K	MCR_HUMAN	Disease (PHA1A)	---	D	N	770	K
04	UniProt	VAR_031274	Q	776	R	MCR_HUMAN	Disease (PHA1A)	---	D	Q	776	R
05	UniProt	VAR_031275	S	805	P	MCR_HUMAN	Disease (PHA1A)	---	D	S	805	P
06	UniProt	VAR_015626	S	810	L	MCR_HUMAN	Disease (EOHSEP)	41511344	D	L	810	L
07	UniProt	VAR_031276	S	815	R	MCR_HUMAN	Disease (PHA1A)	---	D	S	815	R
08	UniProt	VAR_031277	S	818	L	MCR_HUMAN	Disease (PHA1A)	---	D	S	818	L
09	UniProt	VAR_029311	F	826	Y	MCR_HUMAN	Polymorphism	13306592	D	F	826	Y
10	UniProt	VAR_015627	L	924	P	MCR_HUMAN	Disease (PHA1A)	---	D	L	924	P
11	UniProt	VAR_031278	E	972	G	MCR_HUMAN	Disease (PHA1A)	---	D	E	972	G
12	UniProt	VAR_031279	L	979	P	MCR_HUMAN	Disease (PHA1A)	---	D	L	979	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 5 (12, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_031271	P	759	S	MCR_HUMAN	Disease (PHA1A)	---	E	P	759	S
02	UniProt	VAR_031272	L	769	P	MCR_HUMAN	Disease (PHA1A)	---	E	L	769	P
03	UniProt	VAR_031273	N	770	K	MCR_HUMAN	Disease (PHA1A)	---	E	N	770	K
04	UniProt	VAR_031274	Q	776	R	MCR_HUMAN	Disease (PHA1A)	---	E	Q	776	R
05	UniProt	VAR_031275	S	805	P	MCR_HUMAN	Disease (PHA1A)	---	E	S	805	P
06	UniProt	VAR_015626	S	810	L	MCR_HUMAN	Disease (EOHSEP)	41511344	E	L	810	L
07	UniProt	VAR_031276	S	815	R	MCR_HUMAN	Disease (PHA1A)	---	E	S	815	R
08	UniProt	VAR_031277	S	818	L	MCR_HUMAN	Disease (PHA1A)	---	E	S	818	L
09	UniProt	VAR_029311	F	826	Y	MCR_HUMAN	Polymorphism	13306592	E	F	826	Y
10	UniProt	VAR_015627	L	924	P	MCR_HUMAN	Disease (PHA1A)	---	E	L	924	P
11	UniProt	VAR_031278	E	972	G	MCR_HUMAN	Disease (PHA1A)	---	E	E	972	G
12	UniProt	VAR_031279	L	979	P	MCR_HUMAN	Disease (PHA1A)	---	E	L	979	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 6 (11, 11)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
02	UniProt	VAR_031272	L	769	P	MCR_HUMAN	Disease (PHA1A)	---	F	L	769	P
03	UniProt	VAR_031273	N	770	K	MCR_HUMAN	Disease (PHA1A)	---	F	N	770	K
04	UniProt	VAR_031274	Q	776	R	MCR_HUMAN	Disease (PHA1A)	---	F	Q	776	R
05	UniProt	VAR_031275	S	805	P	MCR_HUMAN	Disease (PHA1A)	---	F	S	805	P
06	UniProt	VAR_015626	S	810	L	MCR_HUMAN	Disease (EOHSEP)	41511344	F	L	810	L
07	UniProt	VAR_031276	S	815	R	MCR_HUMAN	Disease (PHA1A)	---	F	S	815	R
08	UniProt	VAR_031277	S	818	L	MCR_HUMAN	Disease (PHA1A)	---	F	S	818	L
09	UniProt	VAR_029311	F	826	Y	MCR_HUMAN	Polymorphism	13306592	F	F	826	Y
10	UniProt	VAR_015627	L	924	P	MCR_HUMAN	Disease (PHA1A)	---	F	L	924	P
11	UniProt	VAR_031278	E	972	G	MCR_HUMAN	Disease (PHA1A)	---	F	E	972	G
12	UniProt	VAR_031279	L	979	P	MCR_HUMAN	Disease (PHA1A)	---	F	L	979	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (5, 30)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:233
 aligned with MCR_HUMAN | P08235 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:245
                                   747       757       767       777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977     
            MCR_HUMAN   738 PVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
               SCOP domains d2oaxa_ A: automate   d matches                                                                                                                                                                                                                       SCOP domains
               CATH domains 2oaxA00 A:738-982 R   etinoid X Receptor                                                                                                                                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhh...........---.hhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeehhhhhhhh.hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.eee.....hhhhhhhhhhhhhhhhhhhhh---------.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..eee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------PK-----R----------------------------P----L----R--L-------Y-------------------------------------------------------------------------------------------------P-----------------------------------------------G------P--- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8a  PDB: A:738-789 (gaps) UniProt: 672-789   -----------------------------------------------Exon 1.11  PDB: A:837-881 UniProt: 837-881   ----------------------------------------------------Exon 1.13f  PDB: A:934-982 UniProt: 934-984       Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------Exon 1.9a  PDB: A:789-837 UniProt: 789-837       -------------------------------------------Exon 1.12  PDB: A:881-933 (gaps) UniProt: 881-933    ------------------------------------------------- Transcript 1 (2)
                 2oax A 738 PVMVLENIEPEIVYAGYDS---DTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLLSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVT---------WQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
                                   747        |-  |    767       777       787       797       807       817       827       837       847       857       867       877       887       897       907|        -|      927       937       947       957       967       977     
                                            756 760                                                                                                                                                 908       918

Chain B from PDB  Type:PROTEIN  Length:233
 aligned with MCR_HUMAN | P08235 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:244
                                   748       758       768       778       788       798       808       818       828       838       848       858       868       878       888       898       908       918       928       938       948       958       968       978    
            MCR_HUMAN   739 VMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
               SCOP domains d2oaxb_ B: automated matches                                                                                                                                                                                                                         SCOP domains
               CATH domains 2oaxB00 B:739-982 Retinoid X Receptor                                                                                                                                                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeehhhhhhhh...hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.eee.....hhhhhhhhhhhhhhhhhhhh-----------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh.......eee.... Sec.struct. author
                 SAPs(SNPs) --------------------S---------PK-----R----------------------------P----L----R--L-------Y-------------------------------------------------------------------------------------------------P-----------------------------------------------G------P--- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8a  PDB: B:739-789 UniProt: 672-789         -----------------------------------------------Exon 1.11  PDB: B:837-881 UniProt: 837-881   ----------------------------------------------------Exon 1.13f  PDB: B:934-982 UniProt: 934-984       Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.9a  PDB: B:789-837 UniProt: 789-837       -------------------------------------------Exon 1.12  PDB: B:881-933 (gaps) UniProt: 881-933    ------------------------------------------------- Transcript 1 (2)
                 2oax B 739 VMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLLSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMV-----------QRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
                                   748       758       768       778       788       798       808       818       828       838       848       858       868       878       888       898        |-         -|      928       938       948       958       968       978    
                                                                                                                                                                                                  907         919

Chain C from PDB  Type:PROTEIN  Length:233
 aligned with MCR_HUMAN | P08235 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:245
                                   747       757       767       777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977     
            MCR_HUMAN   738 PVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
               SCOP domains d2oaxc_ C: automate   d matches                                                                                                                                                                                                                       SCOP domains
               CATH domains 2oaxC00 C:738-982 R   etinoid X Receptor                                                                                                                                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhh..........---.hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeehhhhhhh..hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhh.---------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) -------------------------------PK-----R----------------------------P----L----R--L-------Y-------------------------------------------------------------------------------------------------P-----------------------------------------------G------P--- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8a  PDB: C:738-789 (gaps) UniProt: 672-789   -----------------------------------------------Exon 1.11  PDB: C:837-881 UniProt: 837-881   ----------------------------------------------------Exon 1.13f  PDB: C:934-982 UniProt: 934-984       Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------Exon 1.9a  PDB: C:789-837 UniProt: 789-837       -------------------------------------------Exon 1.12  PDB: C:881-933 (gaps) UniProt: 881-933    ------------------------------------------------- Transcript 1 (2)
                 2oax C 738 PVMVLENIEPEIVYAGYDS---DTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLLSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTK---------QRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
                                   747        |-  |    767       777       787       797       807       817       827       837       847       857       867       877       887       897       907 |       - |     927       937       947       957       967       977     
                                            756 760                                                                                                                                                  909       919

Chain D from PDB  Type:PROTEIN  Length:234
 aligned with MCR_HUMAN | P08235 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:245
                                   747       757       767       777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977     
            MCR_HUMAN   738 PVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
               SCOP domains d2oaxd_ D: automate   d matches                                                                                                                                                                                                                       SCOP domains
               CATH domains 2oaxD00 D:738-982 R   etinoid X Receptor                                                                                                                                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhh...........---.hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeee..eeehhhhhhh....hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.eee.....hhhhhhhhhhhhhhhhhhhh--------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh....eee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------PK-----R----------------------------P----L----R--L-------Y-------------------------------------------------------------------------------------------------P-----------------------------------------------G------P--- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8a  PDB: D:738-789 (gaps) UniProt: 672-789   -----------------------------------------------Exon 1.11  PDB: D:837-881 UniProt: 837-881   ----------------------------------------------------Exon 1.13f  PDB: D:934-982 UniProt: 934-984       Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------Exon 1.9a  PDB: D:789-837 UniProt: 789-837       -------------------------------------------Exon 1.12  PDB: D:881-933 (gaps) UniProt: 881-933    ------------------------------------------------- Transcript 1 (2)
                 2oax D 738 PVMVLENIEPEIVYAGYDS---DTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLLSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMV--------QSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
                                   747        |-  |    767       777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977     
                                            756 760                                                                                                                                                907      916

Chain E from PDB  Type:PROTEIN  Length:234
 aligned with MCR_HUMAN | P08235 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:245
                                   747       757       767       777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977     
            MCR_HUMAN   738 PVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
               SCOP domains d2oaxe_ E: automated matches                                                                                                                                                                                                                          SCOP domains
               CATH domains 2oaxE00 E:738-982 Retinoid X Receptor                                                                                                                                                                                                                 CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeee..eee............hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.eee.....hhhhhhhhhhhhhhhhhhhh-----------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh.eee.... Sec.struct. author
                 SAPs(SNPs) ---------------------S---------PK-----R----------------------------P----L----R--L-------Y-------------------------------------------------------------------------------------------------P-----------------------------------------------G------P--- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8a  PDB: E:738-789 UniProt: 672-789          -----------------------------------------------Exon 1.11  PDB: E:837-881 UniProt: 837-881   ----------------------------------------------------Exon 1.13f  PDB: E:934-982 UniProt: 934-984       Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------Exon 1.9a  PDB: E:789-837 UniProt: 789-837       -------------------------------------------Exon 1.12  PDB: E:881-933 (gaps) UniProt: 881-933    ------------------------------------------------- Transcript 1 (2)
                 2oax E 738 PVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLLSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMV-----------QRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
                                   747       757       767       777       787       797       807       817       827       837       847       857       867       877       887       897       907         - |     927       937       947       957       967       977     
                                                                                                                                                                                                   907         919

Chain F from PDB  Type:PROTEIN  Length:238
 aligned with MCR_HUMAN | P08235 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:245
                                   747       757       767       777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977     
            MCR_HUMAN   738 PVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
               SCOP domains d2oaxf_ F: automate   d matches                                                                                                                                                                                                                       SCOP domains
               CATH domains 2oaxF00 F:738-982 R   etinoid X Receptor                                                                                                                                                                                                              CATH domains
           Pfam domains (1) ----------Hormone_r   ecep-2oaxF01 F:748-960                                                                                                                                                                                   ---------------------- Pfam domains (1)
           Pfam domains (2) ----------Hormone_r   ecep-2oaxF02 F:748-960                                                                                                                                                                                   ---------------------- Pfam domains (2)
           Pfam domains (3) ----------Hormone_r   ecep-2oaxF03 F:748-960                                                                                                                                                                                   ---------------------- Pfam domains (3)
           Pfam domains (4) ----------Hormone_r   ecep-2oaxF04 F:748-960                                                                                                                                                                                   ---------------------- Pfam domains (4)
           Pfam domains (5) ----------Hormone_r   ecep-2oaxF05 F:748-960                                                                                                                                                                                   ---------------------- Pfam domains (5)
           Pfam domains (6) ----------Hormone_r   ecep-2oaxF06 F:748-960                                                                                                                                                                                   ---------------------- Pfam domains (6)
         Sec.struct. author hhhhhhhhh..........---.hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eee.hhhhhhh...hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.eee.....hhhhhhhhhhhhhhhhhhh.----.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhh..eee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------PK-----R----------------------------P----L----R--L-------Y-------------------------------------------------------------------------------------------------P-----------------------------------------------G------P--- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8a  PDB: F:738-789 (gaps) UniProt: 672-789   -----------------------------------------------Exon 1.11  PDB: F:837-881 UniProt: 837-881   ----------------------------------------------------Exon 1.13f  PDB: F:934-982 UniProt: 934-984       Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------Exon 1.9a  PDB: F:789-837 UniProt: 789-837       -------------------------------------------Exon 1.12  PDB: F:881-933 (gaps) UniProt: 881-933    ------------------------------------------------- Transcript 1 (2)
                 2oax F 738 PVMVLENIEPEIVYAGYDS---DTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLLSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMV----NNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
                                   747        |-  |    767       777       787       797       807       817       827       837       847       857       867       877       887       897       907    |  917       927       937       947       957       967       977     
                                            756 760                                                                                                                                                907  912

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 6)

CATH Domains (1, 6)

Pfam Domains (1, 6)

Gene Ontology (21, 21)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F (MCR_HUMAN | P08235)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0005496	steroid binding	Interacting selectively and non-covalently with a steroid, any of a large group of substances that have in common a ring system based on 1,2-cyclopentanoperhydrophenanthrene.
	GO:0003707	steroid hormone receptor activity	Combining with a steroid hormone and transmitting the signal within the cell to initiate a change in cell activity or function.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0043401	steroid hormone mediated signaling pathway	A series of molecular signals mediated by a steroid hormone binding to a receptor.
	GO:0006367	transcription initiation from RNA polymerase II promoter	Any process involved in the assembly of the RNA polymerase II preinitiation complex (PIC) at an RNA polymerase II promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043235	receptor complex	Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (12, 68)

PROSITE Motifs (0, 0)

Exons (5, 30)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 6)

CATH Domains (1, 6)

Pfam Domains (1, 6)

Gene Ontology (21, 21)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File