1YA3 - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE HUMAN MINERALOCORTICOID RECEPTOR LIGAND-BINDING DOMAIN BOUND TO PROGESTERONE AND HARBORING THE S810L MUTATION RESPONSIBLE FOR A SEVERE FORM OF HYPERTENSION

Authors :   J. Fagart, J. Huyet, G. M. Pinon, M. Rochel, C. Mayer, M. E. Rafestin- Oblin

Date :   17 Dec 04 (Deposition) - 24 May 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.34

Chains :   Asym. Unit : A,B,C
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)

Keywords :   Mineralocorticoid Receptor, Steroid Receptor, Nuclear Receptor Transcription Regulation, Activating Mutation, Hypertension (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Fagart, J. Huyet, G. M. Pinon, M. Rochel, C. Mayer, M. E. Rafestin-Oblin
Crystal Structure Of A Mutant Mineralocorticoid Receptor Responsible For Hypertension
Nat. Struct. Mol. Biol. V. 12 554 2005
PubMed-ID: 15908963 | Reference-DOI: 10.1038/NSMB939
(for further references see the PDB file header)

Molecule 1 - MINERALOCORTICOID RECEPTOR
	Chains	:	A, B, C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PMRLBDL810
	Expression System Strain	:	BL21 CODON PLUS (DE3) RIL
	Expression System Taxid	:	562
	Expression System Vector Type	:	PGEX
	Fragment	:	LIGAND-BINDING DOMAIN
	Gene	:	NR3C2, MCR, MLR
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Strain	:	UV20HL21-27
	Synonym	:	MR

		1	2	3
Asymmetric Unit	:	A	B	C
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 3)

No.	Name	Count	Type	Full Name
1	STR	3	Ligand/Ion	PROGESTERONE

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	STR	1	Ligand/Ion	PROGESTERONE

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	STR	1	Ligand/Ion	PROGESTERONE

Biological Unit 3 (1, 1)

No.	Name	Count	Type	Full Name
1	STR	1	Ligand/Ion	PROGESTERONE

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LEU A:766 , LEU A:769 , ASN A:770 , GLN A:776 , LEU A:810 , ARG A:817 , PHE A:829 , MET A:845 , PHE A:941 , CYS A:942	BINDING SITE FOR RESIDUE STR A 1001
2	AC2	SOFTWARE	LEU B:766 , LEU B:769 , ASN B:770 , GLN B:776 , MET B:807 , LEU B:810 , LEU B:814 , ARG B:817 , PHE B:941 , CYS B:942 , THR B:945	BINDING SITE FOR RESIDUE STR B 2001
3	AC3	SOFTWARE	LEU C:766 , LEU C:769 , ASN C:770 , ALA C:773 , GLN C:776 , MET C:807 , LEU C:810 , ARG C:817 , PHE C:829 , MET C:845 , PHE C:941 , CYS C:942 , THR C:945 , HOH C:4035	BINDING SITE FOR RESIDUE STR C 3001

(no "SS Bond" information available for 1YA3)

(no "Cis Peptide Bond" information available for 1YA3)

Asymmetric Unit (11, 33)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_031272	L	769	P	MCR_HUMAN	Disease (PHA1A)	---	A/B/C	L	769	P
02	UniProt	VAR_031273	N	770	K	MCR_HUMAN	Disease (PHA1A)	---	A/B/C	N	770	K
03	UniProt	VAR_031274	Q	776	R	MCR_HUMAN	Disease (PHA1A)	---	A/B/C	Q	776	R
04	UniProt	VAR_031275	S	805	P	MCR_HUMAN	Disease (PHA1A)	---	A/B/C	S	805	P
05	UniProt	VAR_015626	S	810	L	MCR_HUMAN	Disease (EOHSEP)	41511344	A/B/C	L	810	L
06	UniProt	VAR_031276	S	815	R	MCR_HUMAN	Disease (PHA1A)	---	A/B/C	S	815	R
07	UniProt	VAR_031277	S	818	L	MCR_HUMAN	Disease (PHA1A)	---	A/B/C	S	818	L
08	UniProt	VAR_029311	F	826	Y	MCR_HUMAN	Polymorphism	13306592	A/B/C	F	826	Y
09	UniProt	VAR_015627	L	924	P	MCR_HUMAN	Disease (PHA1A)	---	A/B/C	L	924	P
10	UniProt	VAR_031278	E	972	G	MCR_HUMAN	Disease (PHA1A)	---	A/B/C	E	972	G
11	UniProt	VAR_031279	L	979	P	MCR_HUMAN	Disease (PHA1A)	---	A/B/C	L	979	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (11, 11)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_031272	L	769	P	MCR_HUMAN	Disease (PHA1A)	---	A	L	769	P
02	UniProt	VAR_031273	N	770	K	MCR_HUMAN	Disease (PHA1A)	---	A	N	770	K
03	UniProt	VAR_031274	Q	776	R	MCR_HUMAN	Disease (PHA1A)	---	A	Q	776	R
04	UniProt	VAR_031275	S	805	P	MCR_HUMAN	Disease (PHA1A)	---	A	S	805	P
05	UniProt	VAR_015626	S	810	L	MCR_HUMAN	Disease (EOHSEP)	41511344	A	L	810	L
06	UniProt	VAR_031276	S	815	R	MCR_HUMAN	Disease (PHA1A)	---	A	S	815	R
07	UniProt	VAR_031277	S	818	L	MCR_HUMAN	Disease (PHA1A)	---	A	S	818	L
08	UniProt	VAR_029311	F	826	Y	MCR_HUMAN	Polymorphism	13306592	A	F	826	Y
09	UniProt	VAR_015627	L	924	P	MCR_HUMAN	Disease (PHA1A)	---	A	L	924	P
10	UniProt	VAR_031278	E	972	G	MCR_HUMAN	Disease (PHA1A)	---	A	E	972	G
11	UniProt	VAR_031279	L	979	P	MCR_HUMAN	Disease (PHA1A)	---	A	L	979	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (11, 11)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_031272	L	769	P	MCR_HUMAN	Disease (PHA1A)	---	B	L	769	P
02	UniProt	VAR_031273	N	770	K	MCR_HUMAN	Disease (PHA1A)	---	B	N	770	K
03	UniProt	VAR_031274	Q	776	R	MCR_HUMAN	Disease (PHA1A)	---	B	Q	776	R
04	UniProt	VAR_031275	S	805	P	MCR_HUMAN	Disease (PHA1A)	---	B	S	805	P
05	UniProt	VAR_015626	S	810	L	MCR_HUMAN	Disease (EOHSEP)	41511344	B	L	810	L
06	UniProt	VAR_031276	S	815	R	MCR_HUMAN	Disease (PHA1A)	---	B	S	815	R
07	UniProt	VAR_031277	S	818	L	MCR_HUMAN	Disease (PHA1A)	---	B	S	818	L
08	UniProt	VAR_029311	F	826	Y	MCR_HUMAN	Polymorphism	13306592	B	F	826	Y
09	UniProt	VAR_015627	L	924	P	MCR_HUMAN	Disease (PHA1A)	---	B	L	924	P
10	UniProt	VAR_031278	E	972	G	MCR_HUMAN	Disease (PHA1A)	---	B	E	972	G
11	UniProt	VAR_031279	L	979	P	MCR_HUMAN	Disease (PHA1A)	---	B	L	979	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (11, 11)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_031272	L	769	P	MCR_HUMAN	Disease (PHA1A)	---	C	L	769	P
02	UniProt	VAR_031273	N	770	K	MCR_HUMAN	Disease (PHA1A)	---	C	N	770	K
03	UniProt	VAR_031274	Q	776	R	MCR_HUMAN	Disease (PHA1A)	---	C	Q	776	R
04	UniProt	VAR_031275	S	805	P	MCR_HUMAN	Disease (PHA1A)	---	C	S	805	P
05	UniProt	VAR_015626	S	810	L	MCR_HUMAN	Disease (EOHSEP)	41511344	C	L	810	L
06	UniProt	VAR_031276	S	815	R	MCR_HUMAN	Disease (PHA1A)	---	C	S	815	R
07	UniProt	VAR_031277	S	818	L	MCR_HUMAN	Disease (PHA1A)	---	C	S	818	L
08	UniProt	VAR_029311	F	826	Y	MCR_HUMAN	Polymorphism	13306592	C	F	826	Y
09	UniProt	VAR_015627	L	924	P	MCR_HUMAN	Disease (PHA1A)	---	C	L	924	P
10	UniProt	VAR_031278	E	972	G	MCR_HUMAN	Disease (PHA1A)	---	C	E	972	G
11	UniProt	VAR_031279	L	979	P	MCR_HUMAN	Disease (PHA1A)	---	C	L	979	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1YA3)

Asymmetric Unit (5, 15)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2a	ENST00000358102	2a	ENSE00002056278	chr4:149363672-149363312	361	MCR_HUMAN	-	0	0	-	-
1.3a	ENST00000358102	3a	ENSE00001221601	chr4:149358014-149356256	1759	MCR_HUMAN	1-586	586	0	-	-
1.5a	ENST00000358102	5a	ENSE00001221249	chr4:149181269-149181130	140	MCR_HUMAN	586-633	48	0	-	-
1.7b	ENST00000358102	7b	ENSE00001641416	chr4:149116013-149115897	117	MCR_HUMAN	633-672	40	0	-	-
1.8a	ENST00000358102	8a	ENSE00001221232	chr4:149076052-149075702	351	MCR_HUMAN	672-789	118	3	A:737-789 (gaps) B:738-789 (gaps) C:737-789 (gaps)	53 52 53
1.9a	ENST00000358102	9a	ENSE00001000702	chr4:149073764-149073620	145	MCR_HUMAN	789-837	49	3	A:789-837 B:789-837 C:789-837	49 49 49
1.11	ENST00000358102	11	ENSE00001771423	chr4:149041439-149041309	131	MCR_HUMAN	837-881	45	3	A:837-881 B:837-881 C:837-881	45 45 45
1.12	ENST00000358102	12	ENSE00001739163	chr4:149035412-149035255	158	MCR_HUMAN	881-933	53	3	A:881-933 (gaps) B:881-933 (gaps) C:881-933 (gaps)	53 53 53
1.13d	ENST00000358102	13d	ENSE00002035974	chr4:149002650-148999920	2731	MCR_HUMAN	934-984	51	3	A:934-982 B:934-982 C:934-982	49 49 49

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:233
 aligned with MCR_HUMAN | P08235 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:246
                                   746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896       906       916       926       936       946       956       966       976      
            MCR_HUMAN   737 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
               SCOP domains d1ya3a_ A: automat     ed matches                                                                                                                                                                                                                      SCOP domains
               CATH domains 1ya3A00 A:737-982      Retinoid X Receptor                                                                                                                                                                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhh........-----.hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeehhhhhhhh.hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.eee.....hhhhhhhhhhhhhhhhhhhhh--------..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh...eee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------PK-----R----------------------------P----L----R--L-------Y-------------------------------------------------------------------------------------------------P-----------------------------------------------G------P--- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.8a  PDB: A:737-789 (gaps) UniProt: 672-789    -----------------------------------------------Exon 1.11  PDB: A:837-881 UniProt: 837-881   ----------------------------------------------------Exon 1.13d  PDB: A:934-982 UniProt: 934-984       Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.9a  PDB: A:789-837 UniProt: 789-837       -------------------------------------------Exon 1.12  PDB: A:881-933 (gaps) UniProt: 881-933    ------------------------------------------------- Transcript 1 (2)
                 1ya3 A 737 SPVMVLENIEPEIVYAGY-----DTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLLSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVT--------SWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
                                   746       | -   |   766       776       786       796       806       816       826       836       846       856       866       876       886       896       906 |       -|      926       936       946       956       966       976      
                                           754   760                                                                                                                                                 908      917

Chain B from PDB  Type:PROTEIN  Length:230
 aligned with MCR_HUMAN | P08235 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:245
                                   747       757       767       777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977     
            MCR_HUMAN   738 PVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
               SCOP domains d1ya3b_ B: auto       mated matches                                                                                                                                                                                                                   SCOP domains
               CATH domains 1ya3B00 B:738-9       82 Retinoid X Receptor                                                                                                                                                                                                          CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhh......-------.hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeehhhhhhhh.hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.eee.....hhhhhhhhhhhhhhhhhhh..--------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..eee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------PK-----R----------------------------P----L----R--L-------Y-------------------------------------------------------------------------------------------------P-----------------------------------------------G------P--- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8a  PDB: B:738-789 (gaps) UniProt: 672-789   -----------------------------------------------Exon 1.11  PDB: B:837-881 UniProt: 837-881   ----------------------------------------------------Exon 1.13d  PDB: B:934-982 UniProt: 934-984       Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------Exon 1.9a  PDB: B:789-837 UniProt: 789-837       -------------------------------------------Exon 1.12  PDB: B:881-933 (gaps) UniProt: 881-933    ------------------------------------------------- Transcript 1 (2)
                 1ya3 B 738 PVMVLENIEPEIVYA-------DTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLLSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVT--------SWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
                                   747    |    -  |    767       777       787       797       807       817       827       837       847       857       867       877       887       897       907|      917       927       937       947       957       967       977     
                                        752     760                                                                                                                                                 908      917

Chain C from PDB  Type:PROTEIN  Length:232
 aligned with MCR_HUMAN | P08235 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:246
                                   746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896       906       916       926       936       946       956       966       976      
            MCR_HUMAN   737 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
               SCOP domains d1ya3c_ C:    automa   ted matches                                                                                                                                                                                                                     SCOP domains
               CATH domains 1ya3C00 C:   737-982    Retinoid X Receptor                                                                                                                                                                                                            CATH domains
           Pfam domains (1) ----------   Hormone   _recep-1ya3C01 C:750-960                                                                                                                                                                                 ---------------------- Pfam domains (1)
           Pfam domains (2) ----------   Hormone   _recep-1ya3C02 C:750-960                                                                                                                                                                                 ---------------------- Pfam domains (2)
           Pfam domains (3) ----------   Hormone   _recep-1ya3C03 C:750-960                                                                                                                                                                                 ---------------------- Pfam domains (3)
         Sec.struct. author hhhhhhhhh.---.......---.hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeehhhhhhhh.hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.eee.....hhhhhhhhhhhhhhhhhhhhh--------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..eee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------PK-----R----------------------------P----L----R--L-------Y-------------------------------------------------------------------------------------------------P-----------------------------------------------G------P--- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.8a  PDB: C:737-789 (gaps) UniProt: 672-789    -----------------------------------------------Exon 1.11  PDB: C:837-881 UniProt: 837-881   ----------------------------------------------------Exon 1.13d  PDB: C:934-982 UniProt: 934-984       Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.9a  PDB: C:789-837 UniProt: 789-837       -------------------------------------------Exon 1.12  PDB: C:881-933 (gaps) UniProt: 881-933    ------------------------------------------------- Transcript 1 (2)
                 1ya3 C 737 SPVMVLENIE---VYAGYDS---DTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLLSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVT--------SWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
                                   746   |   756   |   766       776       786       796       806       816       826       836       846       856       866       876       886       896       906 |       -|      926       936       946       956       966       976      
                                   746 750   756 760                                                                                                                                                 908      917

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Nuclear receptor ligand-binding domain (609)

Superfamily: Nuclear receptor ligand-binding domain (609)

Family: Nuclear receptor ligand-binding domain (598)

Protein domain: automated matches (140)

Human (Homo sapiens) [TaxId: 9606] (122)

1a	d1ya3a_	A:
1b	d1ya3b_	B:
1c	d1ya3c_	C:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Retinoid X Receptor (409)

Homologous Superfamily: Retinoid X Receptor (409)

Human (Homo sapiens) (337)

1a	1ya3A00	A:737-982
1b	1ya3C00	C:737-982
1c	1ya3B00	B:738-982

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Hormone_recep] (290)

Family: Hormone_recep (290)

Homo sapiens (Human) (244)

1a	Hormone_recep-1ya3C01	C:750-960
1b	Hormone_recep-1ya3C02	C:750-960
1c	Hormone_recep-1ya3C03	C:750-960

Asymmetric Unit(hide GO term definitions)

Chain A,B,C (MCR_HUMAN | P08235)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0005496	steroid binding	Interacting selectively and non-covalently with a steroid, any of a large group of substances that have in common a ring system based on 1,2-cyclopentanoperhydrophenanthrene.
	GO:0003707	steroid hormone receptor activity	Combining with a steroid hormone and transmitting the signal within the cell to initiate a change in cell activity or function.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0043401	steroid hormone mediated signaling pathway	A series of molecular signals mediated by a steroid hormone binding to a receptor.
	GO:0006367	transcription initiation from RNA polymerase II promoter	Any process involved in the assembly of the RNA polymerase II preinitiation complex (PIC) at an RNA polymerase II promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043235	receptor complex	Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		STR	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ya3)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ya3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MCR_HUMAN \| P08235
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	177735
		Disease Information	:	OMIM
	605115
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MCR_HUMAN \| P08235
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1YA3)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 3)

Sites (3, 3)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (11, 33)

PROSITE Motifs (0, 0)

Exons (5, 15)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 3)

CATH Domains (1, 3)

Pfam Domains (1, 3)

Gene Ontology (21, 21)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File