Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE HUMAN MINERALOCORTICOID RECEPTOR LIGAND-BINDING DOMAIN BOUND TO DEOXYCORTICOSTERONE
 
Authors :  J. Huyet, G. -M. Pinon, M. Rochel, C. Mayer, M. -E. Rafestin-Oblin, J. Fagart
Date :  15 Jul 05  (Deposition) - 25 Jul 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.33
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Keywords :  Mineralocorticoid Receptor, Steroid Recepto, Nuclear Recept, Transcription Regulation, Activating Mutation, Hypertension, Transcription Regulator (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Huyet, G. -M. Pinon, M. Rochel, C. Mayer, M. -E. Rafestin-Oblin, J. Fagart
Crystal Structure Of The Human Mineralocorticoid Receptor Ligand-Binding Domain Bound To Deoxycorticosterone
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MINERALOCORTICOID RECEPTOR
    Cell LineUV20HL21-27
    ChainsA, B, C
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Cellular LocationCYTOPLASM
    Expression System PlasmidPGEX
    Expression System StrainBL21 CODON PLUS (DE3) RIL
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentLIGAND-BINDING DOMAIN
    GeneNR3C2, MCR, MLR
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMR

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (1x)A  
Biological Unit 2 (1x) B 
Biological Unit 3 (1x)  C

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 3)

Asymmetric Unit (1, 3)
No.NameCountTypeFull Name
11CA3Ligand/IonDESOXYCORTICOSTERONE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
11CA1Ligand/IonDESOXYCORTICOSTERONE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
11CA1Ligand/IonDESOXYCORTICOSTERONE
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
11CA1Ligand/IonDESOXYCORTICOSTERONE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:769 , ASN A:770 , ALA A:773 , GLN A:776 , MET A:807 , SER A:810 , ARG A:817 , MET A:852 , LEU A:938 , PHE A:941 , CYS A:942 , THR A:945 , VAL A:954 , PHE A:956BINDING SITE FOR RESIDUE 1CA A 1001
2AC2SOFTWARELEU B:769 , ASN B:770 , ALA B:773 , GLN B:776 , MET B:807 , SER B:810 , ARG B:817 , PHE B:829 , PHE B:941 , CYS B:942 , THR B:945 , VAL B:954 , PHE B:956 , HOH B:4002BINDING SITE FOR RESIDUE 1CA B 2001
3AC3SOFTWARELEU C:769 , ASN C:770 , LEU C:772 , ALA C:773 , GLN C:776 , MET C:807 , SER C:810 , LEU C:814 , ARG C:817 , PHE C:829 , PHE C:941 , CYS C:942 , THR C:945 , VAL C:954 , PHE C:956BINDING SITE FOR RESIDUE 1CA C 3001

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2ABI)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2ABI)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (11, 33)

Asymmetric Unit (11, 33)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_031272L769PMCR_HUMANDisease (PHA1A)  ---A/B/CL769P
02UniProtVAR_031273N770KMCR_HUMANDisease (PHA1A)  ---A/B/CN770K
03UniProtVAR_031274Q776RMCR_HUMANDisease (PHA1A)  ---A/B/CQ776R
04UniProtVAR_031275S805PMCR_HUMANDisease (PHA1A)  ---A/B/CS805P
05UniProtVAR_015626S810LMCR_HUMANDisease (EOHSEP)41511344A/B/CS810L
06UniProtVAR_031276S815RMCR_HUMANDisease (PHA1A)  ---A/B/CS815R
07UniProtVAR_031277S818LMCR_HUMANDisease (PHA1A)  ---A/B/CS818L
08UniProtVAR_029311F826YMCR_HUMANPolymorphism13306592A/B/CF826Y
09UniProtVAR_015627L924PMCR_HUMANDisease (PHA1A)  ---A/B/CL924P
10UniProtVAR_031278E972GMCR_HUMANDisease (PHA1A)  ---A/B/CE972G
11UniProtVAR_031279L979PMCR_HUMANDisease (PHA1A)  ---A/B/CL979P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (11, 11)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_031272L769PMCR_HUMANDisease (PHA1A)  ---AL769P
02UniProtVAR_031273N770KMCR_HUMANDisease (PHA1A)  ---AN770K
03UniProtVAR_031274Q776RMCR_HUMANDisease (PHA1A)  ---AQ776R
04UniProtVAR_031275S805PMCR_HUMANDisease (PHA1A)  ---AS805P
05UniProtVAR_015626S810LMCR_HUMANDisease (EOHSEP)41511344AS810L
06UniProtVAR_031276S815RMCR_HUMANDisease (PHA1A)  ---AS815R
07UniProtVAR_031277S818LMCR_HUMANDisease (PHA1A)  ---AS818L
08UniProtVAR_029311F826YMCR_HUMANPolymorphism13306592AF826Y
09UniProtVAR_015627L924PMCR_HUMANDisease (PHA1A)  ---AL924P
10UniProtVAR_031278E972GMCR_HUMANDisease (PHA1A)  ---AE972G
11UniProtVAR_031279L979PMCR_HUMANDisease (PHA1A)  ---AL979P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (11, 11)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_031272L769PMCR_HUMANDisease (PHA1A)  ---BL769P
02UniProtVAR_031273N770KMCR_HUMANDisease (PHA1A)  ---BN770K
03UniProtVAR_031274Q776RMCR_HUMANDisease (PHA1A)  ---BQ776R
04UniProtVAR_031275S805PMCR_HUMANDisease (PHA1A)  ---BS805P
05UniProtVAR_015626S810LMCR_HUMANDisease (EOHSEP)41511344BS810L
06UniProtVAR_031276S815RMCR_HUMANDisease (PHA1A)  ---BS815R
07UniProtVAR_031277S818LMCR_HUMANDisease (PHA1A)  ---BS818L
08UniProtVAR_029311F826YMCR_HUMANPolymorphism13306592BF826Y
09UniProtVAR_015627L924PMCR_HUMANDisease (PHA1A)  ---BL924P
10UniProtVAR_031278E972GMCR_HUMANDisease (PHA1A)  ---BE972G
11UniProtVAR_031279L979PMCR_HUMANDisease (PHA1A)  ---BL979P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (11, 11)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_031272L769PMCR_HUMANDisease (PHA1A)  ---CL769P
02UniProtVAR_031273N770KMCR_HUMANDisease (PHA1A)  ---CN770K
03UniProtVAR_031274Q776RMCR_HUMANDisease (PHA1A)  ---CQ776R
04UniProtVAR_031275S805PMCR_HUMANDisease (PHA1A)  ---CS805P
05UniProtVAR_015626S810LMCR_HUMANDisease (EOHSEP)41511344CS810L
06UniProtVAR_031276S815RMCR_HUMANDisease (PHA1A)  ---CS815R
07UniProtVAR_031277S818LMCR_HUMANDisease (PHA1A)  ---CS818L
08UniProtVAR_029311F826YMCR_HUMANPolymorphism13306592CF826Y
09UniProtVAR_015627L924PMCR_HUMANDisease (PHA1A)  ---CL924P
10UniProtVAR_031278E972GMCR_HUMANDisease (PHA1A)  ---CE972G
11UniProtVAR_031279L979PMCR_HUMANDisease (PHA1A)  ---CL979P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2ABI)

(-) Exons   (5, 15)

Asymmetric Unit (5, 15)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2aENST000003581022aENSE00002056278chr4:149363672-149363312361MCR_HUMAN-00--
1.3aENST000003581023aENSE00001221601chr4:149358014-1493562561759MCR_HUMAN1-5865860--
1.5aENST000003581025aENSE00001221249chr4:149181269-149181130140MCR_HUMAN586-633480--
1.7bENST000003581027bENSE00001641416chr4:149116013-149115897117MCR_HUMAN633-672400--
1.8aENST000003581028aENSE00001221232chr4:149076052-149075702351MCR_HUMAN672-7891183A:737-789 (gaps)
B:737-789 (gaps)
C:737-789 (gaps)
53
53
53
1.9aENST000003581029aENSE00001000702chr4:149073764-149073620145MCR_HUMAN789-837493A:789-837
B:789-837
C:789-837
49
49
49
1.11ENST0000035810211ENSE00001771423chr4:149041439-149041309131MCR_HUMAN837-881453A:837-881
B:837-881
C:837-881
45
45
45
1.12ENST0000035810212ENSE00001739163chr4:149035412-149035255158MCR_HUMAN881-933533A:881-933 (gaps)
B:881-933 (gaps)
C:881-933 (gaps)
53
53
53
1.13dENST0000035810213dENSE00002035974chr4:149002650-1489999202731MCR_HUMAN934-984513A:934-982
B:934-982
C:934-982
49
49
49

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:230
 aligned with MCR_HUMAN | P08235 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:246
                                   746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896       906       916       926       936       946       956       966       976      
            MCR_HUMAN   737 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
               SCOP domains d2abia_ A: automa       ted matches                                                                                                                                                                                                                    SCOP domains
               CATH domains 2abiA00 A:737-982        Retinoid X Receptor                                                                                                                                                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhh........-------hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeehhhhhhhh.hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.eee.....hhhhhhhhhhhhhhhhhhhhh---------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh...eee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------PK-----R----------------------------P----L----R--L-------Y-------------------------------------------------------------------------------------------------P-----------------------------------------------G------P--- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.8a  PDB: A:737-789 (gaps) UniProt: 672-789    -----------------------------------------------Exon 1.11  PDB: A:837-881 UniProt: 837-881   ----------------------------------------------------Exon 1.13d  PDB: A:934-982 UniProt: 934-984       Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.9a  PDB: A:789-837 UniProt: 789-837       -------------------------------------------Exon 1.12  PDB: A:881-933 (gaps) UniProt: 881-933    ------------------------------------------------- Transcript 1 (2)
                 2abi A 737 SPVMVLENIEPEIVYAG-------TAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVT---------WQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
                                   746      |  -    |  766       776       786       796       806       816       826       836       846       856       866       876       886       896       906 |       - |     926       936       946       956       966       976      
                                          753     761                                                                                                                                                908       918                                                                

Chain B from PDB  Type:PROTEIN  Length:234
 aligned with MCR_HUMAN | P08235 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:246
                                   746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896       906       916       926       936       946       956       966       976      
            MCR_HUMAN   737 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
               SCOP domains d2abib_ B: automate    d matches                                                                                                                                                                                                                       SCOP domains
               CATH domains 2abiB00 B:737-982 R    etinoid X Receptor                                                                                                                                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhh..........----.hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeehhhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.eee.....hhhhhhhhhhhhhhhhhhhhh--------..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh....eee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------PK-----R----------------------------P----L----R--L-------Y-------------------------------------------------------------------------------------------------P-----------------------------------------------G------P--- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.8a  PDB: B:737-789 (gaps) UniProt: 672-789    -----------------------------------------------Exon 1.11  PDB: B:837-881 UniProt: 837-881   ----------------------------------------------------Exon 1.13d  PDB: B:934-982 UniProt: 934-984       Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.9a  PDB: B:789-837 UniProt: 789-837       -------------------------------------------Exon 1.12  PDB: B:881-933 (gaps) UniProt: 881-933    ------------------------------------------------- Transcript 1 (2)
                 2abi B 737 SPVMVLENIEPEIVYAGYD----DTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVT--------SWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
                                   746        |-   |   766       776       786       796       806       816       826       836       846       856       866       876       886       896       906 |       -|      926       936       946       956       966       976      
                                            755  760                                                                                                                                                 908      917                                                                 

Chain C from PDB  Type:PROTEIN  Length:234
 aligned with MCR_HUMAN | P08235 from UniProtKB/Swiss-Prot  Length:984

    Alignment length:246
                                   746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896       906       916       926       936       946       956       966       976      
            MCR_HUMAN   737 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
               SCOP domains d2abic_ C: automate    d matches                                                                                                                                                                                                                       SCOP domains
               CATH domains 2abiC00 C:737-982 R    etinoid X Receptor                                                                                                                                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhh..........----.hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeehhhhhhhh.hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.eee.....hhhhhhhhhhhhhhhhhhhhh--------..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..eee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------PK-----R----------------------------P----L----R--L-------Y-------------------------------------------------------------------------------------------------P-----------------------------------------------G------P--- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.8a  PDB: C:737-789 (gaps) UniProt: 672-789    -----------------------------------------------Exon 1.11  PDB: C:837-881 UniProt: 837-881   ----------------------------------------------------Exon 1.13d  PDB: C:934-982 UniProt: 934-984       Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.9a  PDB: C:789-837 UniProt: 789-837       -------------------------------------------Exon 1.12  PDB: C:881-933 (gaps) UniProt: 881-933    ------------------------------------------------- Transcript 1 (2)
                 2abi C 737 SPVMVLENIEPEIVYAGYD----DTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVT--------SWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFH 982
                                   746        |-   |   766       776       786       796       806       816       826       836       846       856       866       876       886       896       906 |       -|      926       936       946       956       966       976      
                                            755  760                                                                                                                                                 908      917                                                                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit

(-) CATH Domains  (1, 3)

Asymmetric Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2ABI)

(-) Gene Ontology  (21, 21)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (MCR_HUMAN | P08235)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
    GO:0005496    steroid binding    Interacting selectively and non-covalently with a steroid, any of a large group of substances that have in common a ring system based on 1,2-cyclopentanoperhydrophenanthrene.
    GO:0003707    steroid hormone receptor activity    Combining with a steroid hormone and transmitting the signal within the cell to initiate a change in cell activity or function.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0043401    steroid hormone mediated signaling pathway    A series of molecular signals mediated by a steroid hormone binding to a receptor.
    GO:0006367    transcription initiation from RNA polymerase II promoter    Any process involved in the assembly of the RNA polymerase II preinitiation complex (PIC) at an RNA polymerase II promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2abi)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2abi
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MCR_HUMAN | P08235
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  177735
    Disease InformationOMIM
  605115
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MCR_HUMAN | P08235
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MCR_HUMAN | P082351y9r 1ya3 2a3i 2aa2 2aa5 2aa6 2aa7 2aax 2ab2 2oax 3vhu 3vhv 3wff 3wfg 4pf3 4tnt 4uda 4udb 5hcv 5l7e 5l7g 5l7h

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2ABI)