1VCW - JenaLib

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:291
 aligned with DEGS_ECO57 | P0AEE4 from UniProtKB/Swiss-Prot  Length:355

    Alignment length:312
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351  
           DEGS_ECO57    42 ETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPA 353
               SCOP domains d1vcwa2 A:42-254 Stress sensor protease DegS, catalytic domain                                                                                                                                                       d1vcwa1 A:                255-353 Stress sensor protease DegS, C-terminal domain                    SCOP domains
               CATH domains 1vcwA01 A:42-145,A:238-254 Trypsin-like serine proteases                                                1vcwA02 A:146-237 Trypsin-like serine proteases                                             1vcwA01          1vcwA03 A:                255-353  [code=2.30.42.10, no name defined]                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhh..eeeeeeee.........eeeeeeeeee.....eeeeehhhhh...eeeee.....eee.eeeee.....eeeee......................eeeeeehhhhh..eeeeeeeee..............eee...........eeee....eeeeeeee.............eeeeehhhhhhhhhhhhhhh....ee......----------------.eeee.......hhhhh...eeee.ee..ee...hhhhhhhhh......eeee..-----...eeee.ee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PDZ  PDB: A:281-326 UniProt: 281-326          --------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1vcw A  42 MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGR----------------GIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVV-----QLTLQVTIQEYPA 353
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261  |      -       281       291       301       311       321       331   |   341       351  
                                                                                                                                                                                                                                                        264              281                                                   335   341

Chain A from PDB  Type:PROTEIN  Length:291
 aligned with DEGS_ECOLI | P0AEE3 from UniProtKB/Swiss-Prot  Length:355

    Alignment length:312
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351  
           DEGS_ECOLI    42 ETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPA 353
               SCOP domains d1vcwa2 A:42-254 Stress sensor protease DegS, catalytic domain                                                                                                                                                       d1vcwa1 A:                255-353 Stress sensor protease DegS, C-terminal domain                    SCOP domains
               CATH domains 1vcwA01 A:42-145,A:238-254 Trypsin-like serine proteases                                                1vcwA02 A:146-237 Trypsin-like serine proteases                                             1vcwA01          1vcwA03 A:                255-353  [code=2.30.42.10, no name defined]                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhh..eeeeeeee.........eeeeeeeeee.....eeeeehhhhh...eeeee.....eee.eeeee.....eeeee......................eeeeeehhhhh..eeeeeeeee..............eee...........eeee....eeeeeeee.............eeeeehhhhhhhhhhhhhhh....ee......----------------.eeee.......hhhhh...eeee.ee..ee...hhhhhhhhh......eeee..-----...eeee.ee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PDZ  PDB: A:281-326 UniProt: 281-326          --------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1vcw A  42 MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGR----------------GIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVV-----QLTLQVTIQEYPA 353
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261  |      -       281       291       301       311       321       331   |   341       351  
                                                                                                                                                                                                                                                        264              281                                                   335   341

Chain B from PDB  Type:PROTEIN  Length:291
 aligned with DEGS_ECO57 | P0AEE4 from UniProtKB/Swiss-Prot  Length:355

    Alignment length:312
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351  
           DEGS_ECO57    42 ETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPA 353
               SCOP domains d1vcwb2 B:42-254 Stress sensor protease DegS, catalytic domain                                                                                                                                                       d1vcwb1 B:                255-353 Stress sensor protease DegS, C-terminal domain                    SCOP domains
               CATH domains 1vcwB01 B:42-145,B:238-254 Trypsin-like serine proteases                                                1vcwB02 B:146-237 Trypsin-like serine proteases                                             1vcwB01          1vcwB03 B:                255-353  [code=2.30.42.10, no name defined]                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhh..eeeeeeee.........ee...eeeee.....eeeeehhhhh...eeeee.....eee....ee.hhh.eeeee......................eeeeeehhhhh..eeeeeeeee..............eee...........eeee....eeeee................eeeeehhhhhhhhhhhhhhh....ee......----------------.eee........hhhhh....eee.ee..ee...hhhhhhhhh......eeee..-----...eeee.ee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PDZ  PDB: B:281-326 UniProt: 281-326          --------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1vcw B  42 MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGR----------------GIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVV-----QLTLQVTIQEYPA 353
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261  |      -       281       291       301       311       321       331   |   341       351  
                                                                                                                                                                                                                                                        264              281                                                   335   341

Chain B from PDB  Type:PROTEIN  Length:291
 aligned with DEGS_ECOLI | P0AEE3 from UniProtKB/Swiss-Prot  Length:355

    Alignment length:312
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351  
           DEGS_ECOLI    42 ETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPA 353
               SCOP domains d1vcwb2 B:42-254 Stress sensor protease DegS, catalytic domain                                                                                                                                                       d1vcwb1 B:                255-353 Stress sensor protease DegS, C-terminal domain                    SCOP domains
               CATH domains 1vcwB01 B:42-145,B:238-254 Trypsin-like serine proteases                                                1vcwB02 B:146-237 Trypsin-like serine proteases                                             1vcwB01          1vcwB03 B:                255-353  [code=2.30.42.10, no name defined]                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhh..eeeeeeee.........ee...eeeee.....eeeeehhhhh...eeeee.....eee....ee.hhh.eeeee......................eeeeeehhhhh..eeeeeeeee..............eee...........eeee....eeeee................eeeeehhhhhhhhhhhhhhh....ee......----------------.eee........hhhhh....eee.ee..ee...hhhhhhhhh......eeee..-----...eeee.ee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PDZ  PDB: B:281-326 UniProt: 281-326          --------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1vcw B  42 MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGR----------------GIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVV-----QLTLQVTIQEYPA 353
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261  |      -       281       291       301       311       321       331   |   341       351  
                                                                                                                                                                                                                                                        264              281                                                   335   341

Chain C from PDB  Type:PROTEIN  Length:291
 aligned with DEGS_ECO57 | P0AEE4 from UniProtKB/Swiss-Prot  Length:355

    Alignment length:312
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351  
           DEGS_ECO57    42 ETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPA 353
               SCOP domains d1vcwc2 C:42-254 Stress sensor protease DegS, catalytic domain                                                                                                                                                       d1vcwc1 C:                255-353 Stress sensor protease DegS, C-terminal domain                    SCOP domains
               CATH domains 1vcwC01 C:42-145,C:238-254 Trypsin-like serine proteases                                                1vcwC02 C:146-237 Trypsin-like serine proteases                                             1vcwC01          1vcwC03 C:                255-353  [code=2.30.42.10, no name defined]                               CATH domains
           Pfam domains (1) --------Trypsin-1vcwC04 C:50-245                                                                                                                                                                            -----------PDZ_2-1v                cwC01 C:257-348                                                     ----- Pfam domains (1)
           Pfam domains (2) --------Trypsin-1vcwC05 C:50-245                                                                                                                                                                            -----------PDZ_2-1v                cwC02 C:257-348                                                     ----- Pfam domains (2)
           Pfam domains (3) --------Trypsin-1vcwC06 C:50-245                                                                                                                                                                            -----------PDZ_2-1v                cwC03 C:257-348                                                     ----- Pfam domains (3)
         Sec.struct. author .....hhhhhhhhh..eeeeeeee.........eeeeeeeeeeee...eeeeehhhhh...eeeee.....eee.eeeeee....eeeee......................eeeeeehhhhh..eeeeeeeee..............eee...........eeee....eeeee................eeeeehhhhhhhhhhhhhhh....ee......----------------.eeee.......hhhhh...eeee..........hhhhhhhhh......eeee..-----...eeee.ee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PDZ  PDB: C:281-326 UniProt: 281-326          --------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1vcw C  42 MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGR----------------GIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVV-----QLTLQVTIQEYPA 353
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261  |      -       281       291       301       311       321       331   |   341       351  
                                                                                                                                                                                                                                                        264              281                                                   335   341

Chain C from PDB  Type:PROTEIN  Length:291
 aligned with DEGS_ECOLI | P0AEE3 from UniProtKB/Swiss-Prot  Length:355

    Alignment length:312
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351  
           DEGS_ECOLI    42 ETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREIAPLHAQGGGIDQLQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPA 353
               SCOP domains d1vcwc2 C:42-254 Stress sensor protease DegS, catalytic domain                                                                                                                                                       d1vcwc1 C:                255-353 Stress sensor protease DegS, C-terminal domain                    SCOP domains
               CATH domains 1vcwC01 C:42-145,C:238-254 Trypsin-like serine proteases                                                1vcwC02 C:146-237 Trypsin-like serine proteases                                             1vcwC01          1vcwC03 C:                255-353  [code=2.30.42.10, no name defined]                               CATH domains
           Pfam domains (1) --------Trypsin-1vcwC04 C:50-245                                                                                                                                                                            -----------PDZ_2-1v                cwC01 C:257-348                                                     ----- Pfam domains (1)
           Pfam domains (2) --------Trypsin-1vcwC05 C:50-245                                                                                                                                                                            -----------PDZ_2-1v                cwC02 C:257-348                                                     ----- Pfam domains (2)
           Pfam domains (3) --------Trypsin-1vcwC06 C:50-245                                                                                                                                                                            -----------PDZ_2-1v                cwC03 C:257-348                                                     ----- Pfam domains (3)
         Sec.struct. author .....hhhhhhhhh..eeeeeeee.........eeeeeeeeeeee...eeeeehhhhh...eeeee.....eee.eeeeee....eeeee......................eeeeeehhhhh..eeeeeeeee..............eee...........eeee....eeeee................eeeeehhhhhhhhhhhhhhh....ee......----------------.eeee.......hhhhh...eeee..........hhhhhhhhh......eeee..-----...eeee.ee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PDZ  PDB: C:281-326 UniProt: 281-326          --------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1vcw C  42 MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGR----------------GIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVV-----QLTLQVTIQEYPA 353
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261  |      -       281       291       301       311       321       331   |   341       351  
                                                                                                                                                                                                                                                        264              281                                                   335   341

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C (DEGS_ECOLI | P0AEE3)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
	GO:0008236	serine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0071218	cellular response to misfolded protein	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a misfolded protein stimulus.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
	GO:0071575	integral component of external side of plasma membrane	The component of the plasma membrane consisting of the gene products that penetrate only the external side of the membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0031226	intrinsic component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having either part of their peptide sequence embedded in the hydrophobic region of the membrane or some other covalently attached group such as a GPI anchor that is similarly embedded in the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0030288	outer membrane-bounded periplasmic space	The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain A,B,C (DEGS_ECO57 | P0AEE4)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
	GO:0008236	serine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0071218	cellular response to misfolded protein	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a misfolded protein stimulus.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0031226	intrinsic component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having either part of their peptide sequence embedded in the hydrophobic region of the membrane or some other covalently attached group such as a GPI anchor that is similarly embedded in the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 3)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 6)

CATH Domains (2, 9)

Pfam Domains (2, 6)

Gene Ontology (13, 23)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File