1RLB - JenaLib

Asymmetric/Biological Unit (91, 354)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_007546	G	26	S	TTHY_HUMAN	Polymorphism	1800458	A/C	G	6	S
02	UniProt	VAR_007547	C	30	R	TTHY_HUMAN	Disease (AMYL-TTR)	121918083	A/B/C/D	C	10	R
03	UniProt	VAR_038959	L	32	P	TTHY_HUMAN	Disease (AMYL-TTR)	121918094	A/B/C/D	L	12	P
04	UniProt	VAR_038960	M	33	I	TTHY_HUMAN	Polymorphism	---	A/B/C/D	M	13	I
05	UniProt	VAR_007548	D	38	E	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	D	18	E
06	UniProt	VAR_007549	D	38	G	TTHY_HUMAN	Disease (AMYL-TTR)	121918098	A/B/C/D	D	18	G
07	UniProt	VAR_007550	V	40	I	TTHY_HUMAN	Disease (AMYL-TTR)	121918093	A/B/C/D	V	20	I
08	UniProt	VAR_038961	S	43	N	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	S	23	N
09	UniProt	VAR_007551	P	44	S	TTHY_HUMAN	Disease (AMYL-TTR)	11541790	A/B/C/D	P	24	S
10	UniProt	VAR_010658	V	48	M	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	V	28	M
11	UniProt	VAR_007552	V	50	A	TTHY_HUMAN	Disease (AMYL-TTR)	79977247	A/B/C/D	V	30	A
12	UniProt	VAR_038962	V	50	G	TTHY_HUMAN	Disease (AMYL-TTR)	79977247	A/B/C/D	V	30	G
13	UniProt	VAR_007553	V	50	L	TTHY_HUMAN	Disease (AMYL-TTR)	28933979	A/B/C/D	V	30	L
14	UniProt	VAR_007554	V	50	M	TTHY_HUMAN	Disease (AMYL-TTR)	28933979	A/B/C/D	V	30	M
15	UniProt	VAR_038963	F	53	C	TTHY_HUMAN	Unclassified	---	A/B/C/D	F	33	C
16	UniProt	VAR_007555	F	53	I	TTHY_HUMAN	Disease (AMYL-TTR)	121918068	A/B/C/D	F	33	I
17	UniProt	VAR_007556	F	53	L	TTHY_HUMAN	Disease (AMYL-TTR)	121918068	A/B/C/D	F	33	L
18	UniProt	VAR_038964	F	53	V	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	F	33	V
19	UniProt	VAR_038965	R	54	T	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	R	34	T
20	UniProt	VAR_038966	K	55	N	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	K	35	N
21	UniProt	VAR_007557	A	56	P	TTHY_HUMAN	Disease (AMYL-TTR)	121918077	A/B/C/D	A	36	P
22	UniProt	VAR_038967	D	58	A	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	D	38	A
23	UniProt	VAR_038968	D	58	V	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	D	38	V
24	UniProt	VAR_038969	W	61	L	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	W	41	L
25	UniProt	VAR_009276	I	59	N	RET4_HUMAN	Disease (RDCCAS)	121918584	E/F	I	41	N
26	UniProt	VAR_038970	E	62	D	TTHY_HUMAN	Disease (AMYL-TTR)	11541796	A/B/C/D	E	42	D
27	UniProt	VAR_007558	E	62	G	TTHY_HUMAN	Disease (AMYL-TTR)	11541796	A/B/C/D	E	42	G
28	UniProt	VAR_038971	F	64	S	TTHY_HUMAN	Disease (AMYL-TTR)	104894665	A/B/C/D	F	44	S
29	UniProt	VAR_007559	A	65	D	TTHY_HUMAN	Disease (AMYL-TTR)	730881169	A/B/C/D	A	45	D
30	UniProt	VAR_038972	A	65	S	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	A	45	S
31	UniProt	VAR_007560	A	65	T	TTHY_HUMAN	Disease (AMYL-TTR)	121918078	A/B/C/D	A	45	T
32	UniProt	VAR_007561	G	67	A	TTHY_HUMAN	Disease (AMYL-TTR)	121918090	A/B/C/D	G	47	A
33	UniProt	VAR_038973	G	67	E	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	G	47	E
34	UniProt	VAR_007562	G	67	R	TTHY_HUMAN	Disease (AMYL-TTR)	387906523	A/B/C/D	G	47	R
35	UniProt	VAR_007563	G	67	V	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	G	47	V
36	UniProt	VAR_007564	T	69	A	TTHY_HUMAN	Disease (AMYL-TTR)	121918081	A/B/C/D	T	49	A
37	UniProt	VAR_038974	T	69	I	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	T	49	I
38	UniProt	VAR_007565	S	70	I	TTHY_HUMAN	Disease (AMYL-TTR)	121918080	A/B/C/D	S	50	I
39	UniProt	VAR_007566	S	70	R	TTHY_HUMAN	Disease (AMYL-TTR)	386134269	A/B/C/D	S	50	R
40	UniProt	VAR_007567	S	72	P	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	S	52	P
41	UniProt	VAR_038975	G	73	E	TTHY_HUMAN	Disease (AMYL-TTR)	121918097	A/B/C/D	G	53	E
42	UniProt	VAR_007568	E	74	G	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	E	54	G
43	UniProt	VAR_038976	E	74	K	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	E	54	K
44	UniProt	VAR_007569	L	75	P	TTHY_HUMAN	Disease (AMYL-TTR)	121918079	A/B/C/D	L	55	P
45	UniProt	VAR_038977	L	75	Q	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	L	55	Q
46	UniProt	VAR_073856	A	73	T	RET4_HUMAN	Disease (MCOPCB10)	794726862	E/F	A	55	T
47	UniProt	VAR_073857	A	75	T	RET4_HUMAN	Disease (MCOPCB10)	794726861	E/F	A	57	T
48	UniProt	VAR_007570	L	78	H	TTHY_HUMAN	Disease (AMYL-TTR)	121918069	A/B/C/D	L	58	H
49	UniProt	VAR_007571	L	78	R	TTHY_HUMAN	Disease (AMYL-TTR)	121918069	A/B/C/D	L	58	R
50	UniProt	VAR_007572	T	79	K	TTHY_HUMAN	Disease (AMYL-TTR)	730881163	A/B/C/D	T	59	K
51	UniProt	VAR_007573	T	80	A	TTHY_HUMAN	Disease (AMYL-TTR)	121918070	A/B/C/D	T	60	A
52	UniProt	VAR_038978	E	81	G	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	E	61	G
53	UniProt	VAR_007574	E	81	K	TTHY_HUMAN	Disease (AMYL-TTR)	121918086	A/B/C/D	E	61	K
54	UniProt	VAR_007575	F	84	L	TTHY_HUMAN	Disease (AMYL-TTR)	121918091	A/B/C/D	F	64	L
55	UniProt	VAR_007576	I	88	L	TTHY_HUMAN	Disease (AMYL-TTR)	121918085	A/B/C/D	I	68	L
56	UniProt	VAR_007577	Y	89	H	TTHY_HUMAN	Disease (AMYL-TTR)	121918100	A/B/C/D	Y	69	H
57	UniProt	VAR_007578	K	90	N	TTHY_HUMAN	Disease (AMYL-TTR)	267607160	A/B/C/D	K	70	N
58	UniProt	VAR_007579	V	91	A	TTHY_HUMAN	Disease (AMYL-TTR)	121918084	A/B/C/D	V	71	A
59	UniProt	VAR_007580	I	93	V	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	I	73	V
60	UniProt	VAR_007581	D	94	H	TTHY_HUMAN	Polymorphism	730881164	A/B/C/D	D	74	H
61	UniProt	VAR_009277	G	93	D	RET4_HUMAN	Disease (RDCCAS)	121918585	E/F	G	75	D
62	UniProt	VAR_007582	S	97	Y	TTHY_HUMAN	Disease (AMYL-TTR)	121918071	A/B/C/D	S	77	Y
63	UniProt	VAR_038979	Y	98	F	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	Y	78	F
64	UniProt	VAR_007583	I	104	N	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	I	84	N
65	UniProt	VAR_007584	I	104	S	TTHY_HUMAN	Disease (AMYL-TTR)	121918072	A/B/C/D	I	84	S
66	UniProt	VAR_038980	I	104	T	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	I	84	T
67	UniProt	VAR_010659	E	109	K	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	E	89	K
68	UniProt	VAR_007585	E	109	Q	TTHY_HUMAN	Disease (AMYL-TTR)	121918082	A/B/C/D	E	89	Q
69	UniProt	VAR_007586	H	110	N	TTHY_HUMAN	Polymorphism	121918074	A/B/C/D	H	90	N
70	UniProt	VAR_007587	A	111	S	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	A	91	S
71	UniProt	VAR_038981	V	114	A	TTHY_HUMAN	Unclassified	---	A/B/C/D	V	94	A
72	UniProt	VAR_007588	A	117	G	TTHY_HUMAN	Disease (AMYL-TTR)	121918087	A/B/C/D	A	97	G
73	UniProt	VAR_038982	A	117	S	TTHY_HUMAN	Disease (AMYL-TTR)	267607161	A/B/C/D	A	97	S
74	UniProt	VAR_007589	G	121	S	TTHY_HUMAN	Polymorphism	755337715	A/B/C/D	G	101	S
75	UniProt	VAR_007590	P	122	R	TTHY_HUMAN	Polymorphism	---	A/B/C/D	P	102	R
76	UniProt	VAR_007591	R	124	C	TTHY_HUMAN	Polymorphism	745834030	A/B/C/D	R	104	C
77	UniProt	VAR_038983	R	124	H	TTHY_HUMAN	Polymorphism	121918095	A/B/C/D	R	104	H
78	UniProt	VAR_038984	T	126	N	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	T	106	N
79	UniProt	VAR_038985	I	127	M	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	I	107	M
80	UniProt	VAR_007592	I	127	V	TTHY_HUMAN	Disease (AMYL-TTR)	121918089	A/B/C/D	I	107	V
81	UniProt	VAR_007593	A	129	T	TTHY_HUMAN	Disease (DTTRH)	267607159	A/B/C/D	A	109	T
82	UniProt	VAR_007594	L	131	M	TTHY_HUMAN	Disease (AMYL-TTR)	121918073	A/B/C/D	L	111	M
83	UniProt	VAR_007595	Y	134	C	TTHY_HUMAN	Disease (AMYL-TTR)	121918075	A/B/C/D	Y	114	C
84	UniProt	VAR_007598	Y	134	H	TTHY_HUMAN	Disease (CTS1)	121918088	A/B/C/D	Y	114	H
85	UniProt	VAR_007596	Y	136	S	TTHY_HUMAN	Disease (AMYL-TTR)	730881167	A/B/C/D	Y	116	S
86	UniProt	VAR_007597	Y	136	V	TTHY_HUMAN	Unclassified	---	A/B/C/D	Y	116	V
87	UniProt	VAR_007599	T	139	M	TTHY_HUMAN	Polymorphism	28933981	A/B/C/D	T	119	M
88	UniProt	VAR_038986	A	140	S	TTHY_HUMAN	Disease (AMYL-TTR)	876658108	A/B/C/D	A	120	S
89	UniProt	VAR_038987	V	142	A	TTHY_HUMAN	Disease (AMYL-TTR)	---	A/B/C/D	V	122	A
90	UniProt	VAR_007600	V	142	I	TTHY_HUMAN	Disease (AMYL-TTR)	28933980	A/B/C/D	V	122	I
91	UniProt	VAR_038988	N	144	S	TTHY_HUMAN	Disease (AMYL-TTR)	144965179	A/B/C/D	N	124	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (3, 10)

Exons (8, 22)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:123
 aligned with TTHY_HUMAN | P02766 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:123
                                    34        44        54        64        74        84        94       104       114       124       134       144   
           TTHY_HUMAN    25 TGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE 147
               SCOP domains d1rlba_ A: Transthyretin (synonym: prealbumin)                                                                              SCOP domains
               CATH domains 1rlbA00 A:5-127  [code=2.60.40.180, no name defined]                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeee..........eeeeeeee...eeeeeeeee...................eeeeee.hhhhhhhh........eeeeee.......eeeeeeeee..eeeeeeeee.... Sec.struct. author
             SAPs(SNPs) (1) -S---R-PI----E-I--NS---M-A--CTNP-A--LD-SD-A-AI-PEGP--HKAG--L---LHNA-VH--YF-----N----KNS--A--G---SR-C-NM-T-M--C-S--MS-A-S--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------G-----------G--I----V---G--S-E-IR---KQ--R--K----------------------S----Q-------S------H--V------H-V-----I----- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -------------------------L--L-----------T-R------------------------------------T------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) -------------------------M--V-------------V-------------------------------------------------------------------------------- SAPs(SNPs) (4)
                PROSITE (2) ----------TRANSTHYRETIN_1 ------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) ----------------------------------------------------------------------------------------------------TRANSTHYRETIN---------- PROSITE (1)
           Transcript 1 (1) Exon 1.2  PDB: A:5-47 UniProt: 24-67       ---------------------------------------------Exon 1.8a  PDB: A:93-127            Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------Exon 1.3a  PDB: A:47-92 UniProt: 67-112       ----------------------------------- Transcript 1 (2)
                 1rlb A   5 TGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEQFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE 127
                                    14        24        34        44        54        64        74        84        94       104       114       124

Chain B from PDB  Type:PROTEIN  Length:120
 aligned with TTHY_HUMAN | P02766 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:120
                                    37        47        57        67        77        87        97       107       117       127       137       147
           TTHY_HUMAN    28 SKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE 147
               SCOP domains d1rlbb_ B: Transthyretin (synonym: prealbumin)                                                                           SCOP domains
               CATH domains 1rlbB00 B:8-127  [code=2.60.40.180, no name defined]                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eeeeee..........eeeeeee.....eeeeeeee.....eee...........eeeeee..hhhhhhh........eeeeee.......eeeeeeeee..eeeeeeeee.... Sec.struct. author
             SAPs(SNPs) (1) --R-PI----E-I--NS---M-A--CTNP-A--LD-SD-A-AI-PEGP--HKAG--L---LHNA-VH--YF-----N----KNS--A--G---SR-C-NM-T-M--C-S--MS-A-S--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------G-----------G--I----V---G--S-E-IR---KQ--R--K----------------------S----Q-------S------H--V------H-V-----I----- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ----------------------L--L-----------T-R------------------------------------T------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ----------------------M--V-------------V-------------------------------------------------------------------------------- SAPs(SNPs) (4)
                PROSITE (2) -------TRANSTHYRETIN_1 ------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) -------------------------------------------------------------------------------------------------TRANSTHYRETIN---------- PROSITE (1)
           Transcript 1 (1) Exon 1.2  PDB: B:8-47 UniProt: 24-67    ---------------------------------------------Exon 1.8a  PDB: B:93-127            Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------Exon 1.3a  PDB: B:47-92 UniProt: 67-112       ----------------------------------- Transcript 1 (2)
                 1rlb B   8 SKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEQFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE 127
                                    17        27        37        47        57        67        77        87        97       107       117       127

Chain C from PDB  Type:PROTEIN  Length:123
 aligned with TTHY_HUMAN | P02766 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:123
                                    34        44        54        64        74        84        94       104       114       124       134       144   
           TTHY_HUMAN    25 TGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE 147
               SCOP domains d1rlbc_ C: Transthyretin (synonym: prealbumin)                                                                              SCOP domains
               CATH domains 1rlbC00 C:5-127  [code=2.60.40.180, no name defined]                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeee..........eeeeeee.....eeeeeeee.....eee...........eeeeee.hhhhhhhh........eeeeee.......eeeeeeee...eeeeeeeee.... Sec.struct. author
             SAPs(SNPs) (1) -S---R-PI----E-I--NS---M-A--CTNP-A--LD-SD-A-AI-PEGP--HKAG--L---LHNA-VH--YF-----N----KNS--A--G---SR-C-NM-T-M--C-S--MS-A-S--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------G-----------G--I----V---G--S-E-IR---KQ--R--K----------------------S----Q-------S------H--V------H-V-----I----- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -------------------------L--L-----------T-R------------------------------------T------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) -------------------------M--V-------------V-------------------------------------------------------------------------------- SAPs(SNPs) (4)
                PROSITE (2) ----------TRANSTHYRETIN_1 ------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) ----------------------------------------------------------------------------------------------------TRANSTHYRETIN---------- PROSITE (1)
           Transcript 1 (1) Exon 1.2  PDB: C:5-47 UniProt: 24-67       ---------------------------------------------Exon 1.8a  PDB: C:93-127            Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------Exon 1.3a  PDB: C:47-92 UniProt: 67-112       ----------------------------------- Transcript 1 (2)
                 1rlb C   5 TGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEQFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE 127
                                    14        24        34        44        54        64        74        84        94       104       114       124

Chain D from PDB  Type:PROTEIN  Length:120
 aligned with TTHY_HUMAN | P02766 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:120
                                    37        47        57        67        77        87        97       107       117       127       137       147
           TTHY_HUMAN    28 SKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE 147
               SCOP domains d1rlbd_ D: Transthyretin (synonym: prealbumin)                                                                           SCOP domains
               CATH domains 1rlbD00 D:8-127  [code=2.60.40.180, no name defined]                                                                     CATH domains
           Pfam domains (1) --Transthyretin-1rlbD01 D:10-121                                                                                  ------ Pfam domains (1)
           Pfam domains (2) --Transthyretin-1rlbD02 D:10-121                                                                                  ------ Pfam domains (2)
           Pfam domains (3) --Transthyretin-1rlbD03 D:10-121                                                                                  ------ Pfam domains (3)
           Pfam domains (4) --Transthyretin-1rlbD04 D:10-121                                                                                  ------ Pfam domains (4)
         Sec.struct. author ......eeeee..........eeeeeee.....eeeeeeee....................eeeee.hhhhhhhh........................eeeeee..eeeeee....... Sec.struct. author
             SAPs(SNPs) (1) --R-PI----E-I--NS---M-A--CTNP-A--LD-SD-A-AI-PEGP--HKAG--L---LHNA-VH--YF-----N----KNS--A--G---SR-C-NM-T-M--C-S--MS-A-S--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------G-----------G--I----V---G--S-E-IR---KQ--R--K----------------------S----Q-------S------H--V------H-V-----I----- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ----------------------L--L-----------T-R------------------------------------T------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ----------------------M--V-------------V-------------------------------------------------------------------------------- SAPs(SNPs) (4)
                PROSITE (2) -------TRANSTHYRETIN_1 ------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) -------------------------------------------------------------------------------------------------TRANSTHYRETIN---------- PROSITE (1)
           Transcript 1 (1) Exon 1.2  PDB: D:8-47 UniProt: 24-67    ---------------------------------------------Exon 1.8a  PDB: D:93-127            Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------Exon 1.3a  PDB: D:47-92 UniProt: 67-112       ----------------------------------- Transcript 1 (2)
                 1rlb D   8 SKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEQFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE 127
                                    17        27        37        47        57        67        77        87        97       107       117       127

Chain E from PDB  Type:PROTEIN  Length:174
 aligned with RET4_HUMAN | P02753 from UniProtKB/Swiss-Prot  Length:201

    Alignment length:174
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188    
           RET4_HUMAN    19 ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYC 192
               SCOP domains d1rlbe_ E: Retinol binding protein                                                                                                                                             SCOP domains
               CATH domains 1rlbE00 E:1-174  [code=2.40.128.20, no name defined]                                                                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhh........hhh..eeeeeeeee...........eeeeee.....eeeeee.eeee...eeee..eeeeeee......eeeeeee.......eeee.eeee.......eeeeeee........eeeeeeee.......hhhhhhhhhhhhh................ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------N-------------T-T-----------------D--------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------LIPOCALIN     --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.4a          Exon 2.5a  PDB: E:20-65 UniProt: 38-83        -----------------------------------Exon 2.8a  PDB: E:101-172 UniProt: 119-190                              -- Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------------------------------Exon 2.6  PDB: E:65-101              ----------------------------------------------------------------------2.9 Transcript 2 (2)
                 1rlb E   1 ERDCRVSSFRVKENFDKARFAGTWYAMAKKDPEGLFLQDNIVAEFSVDENGHMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYETFAVQYSCRLLNLDGTCADSYSFVFARDPSGFSPQVQKIVRQRQEELCLARQYRLIPHNGYC 174
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Chain F from PDB  Type:PROTEIN  Length:174
 aligned with RET4_HUMAN | P02753 from UniProtKB/Swiss-Prot  Length:201

    Alignment length:174
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188    
           RET4_HUMAN    19 ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYC 192
               SCOP domains d1rlbf_ F: Retinol binding protein                                                                                                                                             SCOP domains
               CATH domains 1rlbF00 F:1-174  [code=2.40.128.20, no name defined]                                                                                                                           CATH domains
           Pfam domains (1) --------------------Lipocalin-1rlbF01 F:21-170                                                                                                                            ---- Pfam domains (1)
           Pfam domains (2) --------------------Lipocalin-1rlbF02 F:21-170                                                                                                                            ---- Pfam domains (2)
         Sec.struct. author ................hhhh.eeeeeeeee...........eeeeeee...eeee....eeee...eeee..eeeeeee.....eeeeeeee.......eeeeeeeeeee...eeeeeeeee........eeeeeeee.......hhhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------N-------------T-T-----------------D--------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------LIPOCALIN     --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.4a          Exon 2.5a  PDB: F:20-65 UniProt: 38-83        -----------------------------------Exon 2.8a  PDB: F:101-172 UniProt: 119-190                              -- Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------------------------------Exon 2.6  PDB: F:65-101              ----------------------------------------------------------------------2.9 Transcript 2 (2)
                 1rlb F   1 ERDCRVSSFRVKENFDKARFAGTWYAMAKKDPEGLFLQDNIVAEFSVDENGHMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYETFAVQYSCRLLNLDGTCADSYSFVFARDPSGFSPQVQKIVRQRQEELCLARQYRLIPHNGYC 174
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (2, 6)

CATH Domains (2, 6)

Pfam Domains (2, 6)

Gene Ontology (45, 54)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D (TTHY_HUMAN | P02766)

molecular function
	GO:0005179	hormone activity	The action characteristic of a hormone, any substance formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells in the same organism, upon which it has a specific regulatory action. The term was originally applied to agents with a stimulatory physiological action in vertebrate animals (as opposed to a chalone, which has a depressant action). Usage is now extended to regulatory compounds in lower animals and plants, and to synthetic substances having comparable effects; all bind receptors and trigger some biological process.
	GO:0042562	hormone binding	Interacting selectively and non-covalently with any hormone, naturally occurring substances secreted by specialized cells that affect the metabolism or behavior of other cells possessing functional receptors for the hormone.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
biological process
	GO:0044267	cellular protein metabolic process	The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
	GO:0030198	extracellular matrix organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
	GO:0001523	retinoid metabolic process	The chemical reactions and pathways involving retinoids, any member of a class of isoprenoids that contain or are derived from four prenyl groups linked head-to-tail. Retinoids include retinol and retinal and structurally similar natural derivatives or synthetic compounds, but need not have vitamin A activity.
	GO:0042572	retinol metabolic process	The chemical reactions and pathways involving retinol, one of the three compounds that makes up vitamin A.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Chain E,F (RET4_HUMAN | P02753)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
	GO:0016918	retinal binding	Interacting selectively and non-covalently with retinal, one of the forms of vitamin A. Retinal plays an important role in the visual process in most vertebrates, combining with opsins to form visual pigments in the retina.
	GO:0005501	retinoid binding	Interacting selectively and non-covalently with retinoids, any member of a class of isoprenoids that contain or are derived from four prenyl groups linked head-to-tail. Retinoids include retinol and retinal and structurally similar natural derivatives or synthetic compounds, but need not have vitamin A activity.
	GO:0019841	retinol binding	Interacting selectively and non-covalently with retinol, vitamin A1, 2,6,6-trimethyl-1-(9'-hydroxy-3',7'-dimethylnona-1',3',5',7'-tetraenyl)cyclohex-1-ene, one of the three components that makes up vitamin A. Retinol is an intermediate in the vision cycle and it also plays a role in growth and differentiation.
	GO:0034632	retinol transporter activity	Enables the directed movement of retinol into, out of or within a cell, or between cells. Retinol is vitamin A1, 2,6,6-trimethyl-1-(9'-hydroxy-3',7'-dimethylnona-1',3',5',7'-tetraenyl)cyclohex-1-ene, one of the three components that makes up vitamin A.
	GO:0036094	small molecule binding	Interacting selectively and non-covalently with a small molecule, any low molecular weight, monomeric, non-encoded molecule.
	GO:0005215	transporter activity	Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
	GO:0048738	cardiac muscle tissue development	The process whose specific outcome is the progression of cardiac muscle over time, from its formation to the mature structure.
	GO:0048562	embryonic organ morphogenesis	Morphogenesis, during the embryonic phase, of a tissue or tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
	GO:0060059	embryonic retina morphogenesis in camera-type eye	The process in which the anatomical structure of the retina is generated and organized in a camera-type eye during the embryonic life stage.
	GO:0048706	embryonic skeletal system development	The process, occurring during the embryonic phase, whose specific outcome is the progression of the skeleton over time, from its formation to the mature structure.
	GO:0001654	eye development	The process whose specific outcome is the progression of the eye over time, from its formation to the mature structure. The eye is the organ of sight.
	GO:0048807	female genitalia morphogenesis	The process in which the anatomical structures of female genitalia are generated and organized.
	GO:0006094	gluconeogenesis	The formation of glucose from noncarbohydrate precursors, such as pyruvate, amino acids and glycerol.
	GO:0042593	glucose homeostasis	Any process involved in the maintenance of an internal steady state of glucose within an organism or cell.
	GO:0007507	heart development	The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
	GO:0060347	heart trabecula formation	The process of creating a trabecula in the heart. A trabecula is a tissue element in the form of a small beam, strut or rod.
	GO:0030324	lung development	The process whose specific outcome is the progression of the lung over time, from its formation to the mature structure. In all air-breathing vertebrates the lungs are developed from the ventral wall of the oesophagus as a pouch which divides into two sacs. In amphibians and many reptiles the lungs retain very nearly this primitive sac-like character, but in the higher forms the connection with the esophagus becomes elongated into the windpipe and the inner walls of the sacs become more and more divided, until, in the mammals, the air spaces become minutely divided into tubes ending in small air cells, in the walls of which the blood circulates in a fine network of capillaries. In mammals the lungs are more or less divided into lobes, and each lung occupies a separate cavity in the thorax.
	GO:0030277	maintenance of gastrointestinal epithelium	Protection of epithelial surfaces of the gastrointestinal tract from proteolytic and caustic digestive agents.
	GO:0060044	negative regulation of cardiac muscle cell proliferation	Any process that stops, prevents, or reduces the frequency, rate or extent of cardiac muscle cell proliferation.
	GO:0051024	positive regulation of immunoglobulin secretion	Any process that activates or increases the frequency, rate or extent of the regulated release of immunoglobulins from a cell.
	GO:0032024	positive regulation of insulin secretion	Any process that activates or increases the frequency, rate or extent of the regulated release of insulin.
	GO:0045471	response to ethanol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
	GO:0032526	response to retinoic acid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a retinoic acid stimulus.
	GO:0050896	response to stimulus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus. The process begins with detection of the stimulus and ends with a change in state or activity or the cell or organism.
	GO:0001523	retinoid metabolic process	The chemical reactions and pathways involving retinoids, any member of a class of isoprenoids that contain or are derived from four prenyl groups linked head-to-tail. Retinoids include retinol and retinal and structurally similar natural derivatives or synthetic compounds, but need not have vitamin A activity.
	GO:0042572	retinol metabolic process	The chemical reactions and pathways involving retinol, one of the three compounds that makes up vitamin A.
	GO:0034633	retinol transport	The directed movement of retinol into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Retinol is vitamin A1, 2,6,6-trimethyl-1-(9'-hydroxy-3',7'-dimethylnona-1',3',5',7'-tetraenyl)cyclohex-1-ene, one of the three components that makes up vitamin A.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0060157	urinary bladder development	The process whose specific outcome is the progression of the urinary bladder over time, from its formation to the mature structure. The urinary bladder is an elastic, muscular sac situated in the anterior part of the pelvic cavity in which urine collects before excretion.
	GO:0060065	uterus development	The reproductive developmental process whose specific outcome is the progression of the uterus over time, from its formation to the mature structure.
	GO:0060068	vagina development	The reproductive developmental process whose specific outcome is the progression of the vagina over time, from its formation to the mature structure.
	GO:0007601	visual perception	The series of events required for an organism to receive a visual stimulus, convert it to a molecular signal, and recognize and characterize the signal. Visual stimuli are detected in the form of photons and are processed to form an image.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (6, 6)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (91, 354)

PROSITE Motifs (3, 10)

Exons (8, 22)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 6)

CATH Domains (2, 6)

Pfam Domains (2, 6)

Gene Ontology (45, 54)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File