Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE STRUCTURE OF HUMAN RETINOL BINDING PROTEIN WITH ITS CARRIER PROTEIN TRANSTHYRETIN REVEALS INTERACTION WITH THE CARBOXY TERMINUS OF RBP
 
Authors :  H. M. Naylor, M. E. Newcomer
Date :  03 Feb 99  (Deposition) - 16 Feb 99  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.20
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F
Keywords :  Human Serum Retinol Binding Protein, Transthyretin, Prealbumin, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. M. Naylor, M. E. Newcomer
The Structure Of Human Retinol-Binding Protein (Rbp) With Its Carrier Protein Transthyretin Reveals An Interaction With The Carboxy Terminus Of Rbp.
Biochemistry V. 38 2647 1999
PubMed-ID: 10052934  |  Reference-DOI: 10.1021/BI982291I

(-) Compounds

Molecule 1 - PROTEIN (TRANSTHYRETIN)
    ChainsA, B, C, D
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPREALBUMIN
 
Molecule 2 - PROTEIN (RETINOL BINDING PROTEIN)
    ChainsE, F
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymRBP

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit ABCDEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1RTL2Ligand/IonRETINOL

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY D:83 , PHE E:36 , ALA E:57 , MET E:73 , TYR E:90 , LEU E:97BINDING SITE FOR RESIDUE RTL E 1
2AC2SOFTWAREGLY B:83 , LEU F:35 , PHE F:36 , ALA F:55 , ALA F:57 , MET F:73 , VAL F:74 , MET F:88 , TYR F:90 , LEU F:97 , GLN F:98BINDING SITE FOR RESIDUE RTL F 2

(-) SS Bonds  (5, 5)

Asymmetric/Biological Unit
No.Residues
1E:4 -E:160
2E:70 -E:174
3E:120 -E:129
4F:70 -F:174
5F:120 -F:129

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1QAB)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (91, 351)

Asymmetric/Biological Unit (91, 351)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_007546G26STTHY_HUMANPolymorphism1800458AG6S
02UniProtVAR_007547C30RTTHY_HUMANDisease (AMYL-TTR)121918083A/B/C/DC10R
03UniProtVAR_038959L32PTTHY_HUMANDisease (AMYL-TTR)121918094A/B/C/DL12P
04UniProtVAR_038960M33ITTHY_HUMANPolymorphism  ---A/B/C/DM13I
05UniProtVAR_007548D38ETTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DD18E
06UniProtVAR_007549D38GTTHY_HUMANDisease (AMYL-TTR)121918098A/B/C/DD18G
07UniProtVAR_007550V40ITTHY_HUMANDisease (AMYL-TTR)121918093A/B/C/DV20I
08UniProtVAR_038961S43NTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DS23N
09UniProtVAR_007551P44STTHY_HUMANDisease (AMYL-TTR)11541790A/B/C/DP24S
10UniProtVAR_010658V48MTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DV28M
11UniProtVAR_007552V50ATTHY_HUMANDisease (AMYL-TTR)79977247A/B/C/DV30A
12UniProtVAR_038962V50GTTHY_HUMANDisease (AMYL-TTR)79977247A/B/C/DV30G
13UniProtVAR_007553V50LTTHY_HUMANDisease (AMYL-TTR)28933979A/B/C/DV30L
14UniProtVAR_007554V50MTTHY_HUMANDisease (AMYL-TTR)28933979A/B/C/DV30M
15UniProtVAR_038963F53CTTHY_HUMANUnclassified  ---A/B/C/DF33C
16UniProtVAR_007555F53ITTHY_HUMANDisease (AMYL-TTR)121918068A/B/C/DF33I
17UniProtVAR_007556F53LTTHY_HUMANDisease (AMYL-TTR)121918068A/B/C/DF33L
18UniProtVAR_038964F53VTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DF33V
19UniProtVAR_038965R54TTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DR34T
20UniProtVAR_038966K55NTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DK35N
21UniProtVAR_007557A56PTTHY_HUMANDisease (AMYL-TTR)121918077A/B/C/DA36P
22UniProtVAR_038967D58ATTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DD38A
23UniProtVAR_038968D58VTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DD38V
24UniProtVAR_038969W61LTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DW41L
25UniProtVAR_009276I59NRET4_HUMANDisease (RDCCAS)121918584E/FI41N
26UniProtVAR_038970E62DTTHY_HUMANDisease (AMYL-TTR)11541796A/B/C/DE42D
27UniProtVAR_007558E62GTTHY_HUMANDisease (AMYL-TTR)11541796A/B/C/DE42G
28UniProtVAR_038971F64STTHY_HUMANDisease (AMYL-TTR)104894665A/B/C/DF44S
29UniProtVAR_007559A65DTTHY_HUMANDisease (AMYL-TTR)730881169A/B/C/DA45D
30UniProtVAR_038972A65STTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DA45S
31UniProtVAR_007560A65TTTHY_HUMANDisease (AMYL-TTR)121918078A/B/C/DA45T
32UniProtVAR_007561G67ATTHY_HUMANDisease (AMYL-TTR)121918090A/B/C/DG47A
33UniProtVAR_038973G67ETTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DG47E
34UniProtVAR_007562G67RTTHY_HUMANDisease (AMYL-TTR)387906523A/B/C/DG47R
35UniProtVAR_007563G67VTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DG47V
36UniProtVAR_007564T69ATTHY_HUMANDisease (AMYL-TTR)121918081A/B/C/DT49A
37UniProtVAR_038974T69ITTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DT49I
38UniProtVAR_007565S70ITTHY_HUMANDisease (AMYL-TTR)121918080A/B/C/DS50I
39UniProtVAR_007566S70RTTHY_HUMANDisease (AMYL-TTR)386134269A/B/C/DS50R
40UniProtVAR_007567S72PTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DS52P
41UniProtVAR_038975G73ETTHY_HUMANDisease (AMYL-TTR)121918097A/B/C/DG53E
42UniProtVAR_007568E74GTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DE54G
43UniProtVAR_038976E74KTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DE54K
44UniProtVAR_007569L75PTTHY_HUMANDisease (AMYL-TTR)121918079A/B/C/DL55P
45UniProtVAR_038977L75QTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DL55Q
46UniProtVAR_073856A73TRET4_HUMANDisease (MCOPCB10)794726862E/FA55T
47UniProtVAR_073857A75TRET4_HUMANDisease (MCOPCB10)794726861E/FA57T
48UniProtVAR_007570L78HTTHY_HUMANDisease (AMYL-TTR)121918069A/B/C/DL58H
49UniProtVAR_007571L78RTTHY_HUMANDisease (AMYL-TTR)121918069A/B/C/DL58R
50UniProtVAR_007572T79KTTHY_HUMANDisease (AMYL-TTR)730881163A/B/C/DT59K
51UniProtVAR_007573T80ATTHY_HUMANDisease (AMYL-TTR)121918070A/B/C/DT60A
52UniProtVAR_038978E81GTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DE61G
53UniProtVAR_007574E81KTTHY_HUMANDisease (AMYL-TTR)121918086A/B/C/DE61K
54UniProtVAR_007575F84LTTHY_HUMANDisease (AMYL-TTR)121918091A/B/C/DF64L
55UniProtVAR_007576I88LTTHY_HUMANDisease (AMYL-TTR)121918085A/B/C/DI68L
56UniProtVAR_007577Y89HTTHY_HUMANDisease (AMYL-TTR)121918100A/B/C/DY69H
57UniProtVAR_007578K90NTTHY_HUMANDisease (AMYL-TTR)267607160A/B/C/DK70N
58UniProtVAR_007579V91ATTHY_HUMANDisease (AMYL-TTR)121918084A/B/C/DV71A
59UniProtVAR_007580I93VTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DI73V
60UniProtVAR_007581D94HTTHY_HUMANPolymorphism730881164A/B/C/DD74H
61UniProtVAR_009277G93DRET4_HUMANDisease (RDCCAS)121918585E/FG75D
62UniProtVAR_007582S97YTTHY_HUMANDisease (AMYL-TTR)121918071A/B/C/DS77Y
63UniProtVAR_038979Y98FTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DY78F
64UniProtVAR_007583I104NTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DI84N
65UniProtVAR_007584I104STTHY_HUMANDisease (AMYL-TTR)121918072A/B/C/DI84S
66UniProtVAR_038980I104TTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DI84T
67UniProtVAR_010659E109KTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DE89K
68UniProtVAR_007585E109QTTHY_HUMANDisease (AMYL-TTR)121918082A/B/C/DE89Q
69UniProtVAR_007586H110NTTHY_HUMANPolymorphism121918074A/B/C/DH90N
70UniProtVAR_007587A111STTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DA91S
71UniProtVAR_038981V114ATTHY_HUMANUnclassified  ---A/B/C/DV94A
72UniProtVAR_007588A117GTTHY_HUMANDisease (AMYL-TTR)121918087A/B/C/DA97G
73UniProtVAR_038982A117STTHY_HUMANDisease (AMYL-TTR)267607161A/B/C/DA97S
74UniProtVAR_007589G121STTHY_HUMANPolymorphism755337715A/B/C/DG101S
75UniProtVAR_007590P122RTTHY_HUMANPolymorphism  ---A/B/C/DP102R
76UniProtVAR_007591R124CTTHY_HUMANPolymorphism745834030A/B/C/DR104C
77UniProtVAR_038983R124HTTHY_HUMANPolymorphism121918095A/B/C/DR104H
78UniProtVAR_038984T126NTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DT106N
79UniProtVAR_038985I127MTTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DI107M
80UniProtVAR_007592I127VTTHY_HUMANDisease (AMYL-TTR)121918089A/B/C/DI107V
81UniProtVAR_007593A129TTTHY_HUMANDisease (DTTRH)267607159A/B/C/DA109T
82UniProtVAR_007594L131MTTHY_HUMANDisease (AMYL-TTR)121918073A/B/C/DL111M
83UniProtVAR_007595Y134CTTHY_HUMANDisease (AMYL-TTR)121918075A/B/C/DY114C
84UniProtVAR_007598Y134HTTHY_HUMANDisease (CTS1)121918088A/B/C/DY114H
85UniProtVAR_007596Y136STTHY_HUMANDisease (AMYL-TTR)730881167A/B/C/DY116S
86UniProtVAR_007597Y136VTTHY_HUMANUnclassified  ---A/B/C/DY116V
87UniProtVAR_007599T139MTTHY_HUMANPolymorphism28933981A/B/C/DT119M
88UniProtVAR_038986A140STTHY_HUMANDisease (AMYL-TTR)876658108A/B/C/DA120S
89UniProtVAR_038987V142ATTHY_HUMANDisease (AMYL-TTR)  ---A/B/C/DV122A
90UniProtVAR_007600V142ITTHY_HUMANDisease (AMYL-TTR)28933980A/B/C/DV122I
91UniProtVAR_038988N144STTHY_HUMANDisease (AMYL-TTR)144965179A/BN124S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 10)

Asymmetric/Biological Unit (3, 10)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LIPOCALINPS00213 Lipocalin signature.RET4_HUMAN32-45
 
  2E:14-27
F:14-27
2TRANSTHYRETIN_1PS00768 Transthyretin signature 1.TTHY_HUMAN35-50
 
 
 
  4A:15-30
B:15-30
C:15-30
D:15-30
3TRANSTHYRETIN_2PS00769 Transthyretin signature 2.TTHY_HUMAN125-137
 
 
 
  4A:105-117
B:105-117
C:105-117
D:105-117

(-) Exons   (9, 23)

Asymmetric/Biological Unit (9, 23)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002370141aENSE00001836564chr18:29171689-29171934246TTHY_HUMAN1-23231A:1-3
-
-
-
3
-
-
-
1.2ENST000002370142ENSE00000796938chr18:29172859-29172989131TTHY_HUMAN24-67444A:4-47
B:10-47
C:10-47
D:10-47
44
38
38
38
1.3aENST000002370143aENSE00000796939chr18:29175083-29175218136TTHY_HUMAN67-112464A:47-92
B:47-92
C:47-92
D:47-92
46
46
46
46
1.8aENST000002370148aENSE00001827041chr18:29178531-29178974444TTHY_HUMAN113-147354A:93-124
B:93-127
C:93-123
D:93-122
32
35
31
30

2.2aENST000003714672aENSE00001455291chr10:95361420-95361119302RET4_HUMAN-00--
2.4aENST000003714674aENSE00001455290chr10:95360803-95360675129RET4_HUMAN1-37372E:4-19
F:4-19
16
16
2.5aENST000003714675aENSE00000932979chr10:95360560-95360424137RET4_HUMAN38-83462E:20-65
F:20-65
46
46
2.6ENST000003714676ENSE00000932978chr10:95360256-95360150107RET4_HUMAN83-119372E:65-101
F:65-101
37
37
2.8aENST000003714678aENSE00000932977chr10:95353792-95353580213RET4_HUMAN119-190722E:101-172
F:101-172
72
72
2.9cENST000003714679cENSE00001455294chr10:95351869-95351444426RET4_HUMAN190-201122E:172-183
F:172-174
12
3

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:124
 aligned with TTHY_HUMAN | P02766 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:124
                                    30        40        50        60        70        80        90       100       110       120       130       140    
           TTHY_HUMAN    21 GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTN 144
               SCOP domains d1qaba_ A: Transthyretin (synonym: prealbumin)                                                                               SCOP domains
               CATH domains 1qabA00 A:1-124  [code=2.60.40.180, no name defined]                                                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............................eeeeee.....eee.......................eeeeeee.hhhhhhhh........eeeeeee........................... Sec.struct. author
             SAPs(SNPs) (1) -----S---R-PI----E-I--NS---M-A--CTNP-A--LD-SD-A-AI-PEGP--HKAG--L---LHNA-VH--YF-----N----KNS--A--G---SR-C-NM-T-M--C-S--MS-A-S SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------G-----------G--I----V---G--S-E-IR---KQ--R--K----------------------S----Q-------S------H--V------H-V-----I-- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----------------------------L--L-----------T-R------------------------------------T---------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) -----------------------------M--V-------------V----------------------------------------------------------------------------- SAPs(SNPs) (4)
                PROSITE (2) --------------TRANSTHYRETIN_1 ---------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) --------------------------------------------------------------------------------------------------------TRANSTHYRETIN------- PROSITE (1)
           Transcript 1 (1) 1.1Exon 1.2  PDB: A:4-47 UniProt: 24-67        ---------------------------------------------Exon 1.8a  PDB: A:93-124         Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------Exon 1.3a  PDB: A:47-92 UniProt: 67-112       -------------------------------- Transcript 1 (2)
                 1qab A   1 GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEQFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTN 124
                                    10        20        30        40        50        60        70        80        90       100       110       120    

Chain B from PDB  Type:PROTEIN  Length:118
 aligned with TTHY_HUMAN | P02766 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:118
                                    39        49        59        69        79        89        99       109       119       129       139        
           TTHY_HUMAN    30 CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE 147
               SCOP domains d1qabb_ B: Transthyretin (synonym: prealbumin)                                                                         SCOP domains
               CATH domains 1qabB00 B:10-127  [code=2.60.40.180, no name defined]                                                                  CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.............eeeeee........eeeeee.....ee...........eeeeeee..hhhhh..........eeeeeee.............................. Sec.struct. author
             SAPs(SNPs) (1) R-PI----E-I--NS---M-A--CTNP-A--LD-SD-A-AI-PEGP--HKAG--L---LHNA-VH--YF-----N----KNS--A--G---SR-C-NM-T-M--C-S--MS-A-S--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------G-----------G--I----V---G--S-E-IR---KQ--R--K----------------------S----Q-------S------H--V------H-V-----I----- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------------------L--L-----------T-R------------------------------------T------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) --------------------M--V-------------V-------------------------------------------------------------------------------- SAPs(SNPs) (4)
                PROSITE (2) -----TRANSTHYRETIN_1 ------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) -----------------------------------------------------------------------------------------------TRANSTHYRETIN---------- PROSITE (1)
           Transcript 1 (1) Exon 1.2  PDB: B:10-47 UniProt: 24-67 ---------------------------------------------Exon 1.8a  PDB: B:93-127            Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.3a  PDB: B:47-92 UniProt: 67-112       ----------------------------------- Transcript 1 (2)
                 1qab B  10 CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEQFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE 127
                                    19        29        39        49        59        69        79        89        99       109       119        

Chain C from PDB  Type:PROTEIN  Length:114
 aligned with TTHY_HUMAN | P02766 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:114
                                    39        49        59        69        79        89        99       109       119       129       139    
           TTHY_HUMAN    30 CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVT 143
               SCOP domains d1qabc_ C: Transthyretin (synonym: prealbumin)                                                                     SCOP domains
               CATH domains 1qabC00 C:10-123  [code=2.60.40.180, no name defined]                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeee....ee....eeeeeee.....eeeeeeee..................eeeeeee..hhhhh..........eeeeeee.........eeeee.....eeee... Sec.struct. author
             SAPs(SNPs) (1) R-PI----E-I--NS---M-A--CTNP-A--LD-SD-A-AI-PEGP--HKAG--L---LHNA-VH--YF-----N----KNS--A--G---SR-C-NM-T-M--C-S--MS-A- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------G-----------G--I----V---G--S-E-IR---KQ--R--K----------------------S----Q-------S------H--V------H-V-----I- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------------------L--L-----------T-R------------------------------------T--------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) --------------------M--V-------------V---------------------------------------------------------------------------- SAPs(SNPs) (4)
                PROSITE (2) -----TRANSTHYRETIN_1 --------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) -----------------------------------------------------------------------------------------------TRANSTHYRETIN------ PROSITE (1)
           Transcript 1 (1) Exon 1.2  PDB: C:10-47 UniProt: 24-67 ---------------------------------------------Exon 1.8a  PDB: C:93-123        Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.3a  PDB: C:47-92 UniProt: 67-112       ------------------------------- Transcript 1 (2)
                 1qab C  10 CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEQFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVT 123
                                    19        29        39        49        59        69        79        89        99       109       119    

Chain D from PDB  Type:PROTEIN  Length:113
 aligned with TTHY_HUMAN | P02766 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:113
                                    39        49        59        69        79        89        99       109       119       129       139   
           TTHY_HUMAN    30 CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVV 142
               SCOP domains d1qabd_ D: Transthyretin (synonym: prealbumin)                                                                    SCOP domains
               CATH domains 1qabD00 D:10-122  [code=2.60.40.180, no name defined]                                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee.ee...........eeeeee.....eeeeeee......ee...........eeeeeee..hhhhh.......eee...eeee..........eeee....eeee... Sec.struct. author
             SAPs(SNPs) (1) R-PI----E-I--NS---M-A--CTNP-A--LD-SD-A-AI-PEGP--HKAG--L---LHNA-VH--YF-----N----KNS--A--G---SR-C-NM-T-M--C-S--MS-A SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------G-----------G--I----V---G--S-E-IR---KQ--R--K----------------------S----Q-------S------H--V------H-V-----I SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------------------L--L-----------T-R------------------------------------T-------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) --------------------M--V-------------V--------------------------------------------------------------------------- SAPs(SNPs) (4)
                PROSITE (2) -----TRANSTHYRETIN_1 -------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) -----------------------------------------------------------------------------------------------TRANSTHYRETIN----- PROSITE (1)
           Transcript 1 (1) Exon 1.2  PDB: D:10-47 UniProt: 24-67 ---------------------------------------------Exon 1.8a  PDB: D:93-122       Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.3a  PDB: D:47-92 UniProt: 67-112       ------------------------------ Transcript 1 (2)
                 1qab D  10 CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEQFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVV 122
                                    19        29        39        49        59        69        79        89        99       109       119   

Chain E from PDB  Type:PROTEIN  Length:180
 aligned with RET4_HUMAN | P02753 from UniProtKB/Swiss-Prot  Length:201

    Alignment length:180
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201
           RET4_HUMAN    22 CRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL 201
               SCOP domains d1qabe_ E: Retinol binding protein                                                                                                                                                   SCOP domains
               CATH domains 1qabE00 E:4-183  [code=2.40.128.20, no name defined]                                                                                                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .............hhh......................................eeee.......eeee..ee...........eee.........eee.............eee...............eee...........hhhh................................ Sec.struct. author
                 SAPs(SNPs) -------------------------------------N-------------T-T-----------------D------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------LIPOCALIN     ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 2 (1) Exon 2.4a       Exon 2.5a  PDB: E:20-65 UniProt: 38-83        -----------------------------------Exon 2.8a  PDB: E:101-172 UniProt: 119-190                              ----------- Transcript 2 (1)
           Transcript 2 (2) -------------------------------------------------------------Exon 2.6  PDB: E:65-101              ----------------------------------------------------------------------Exon 2.9c    Transcript 2 (2)
                 1qab E   4 CAVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVAQRQEELCLAAQYRLIVHNGYCDGRSERNLL 183
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183

Chain F from PDB  Type:PROTEIN  Length:171
 aligned with RET4_HUMAN | P02753 from UniProtKB/Swiss-Prot  Length:201

    Alignment length:171
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191 
           RET4_HUMAN    22 CRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYC 192
               SCOP domains d1qabf_ F: Retinol binding protein                                                                                                                                          SCOP domains
               CATH domains 1qabF00 F:4-174  [code=2.40.128.20, no name defined]                                                                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhh..eee.............eeeeee...........eeeeee.......eeee..eee.........eeee.........eeee....ee.....eee..eeee......eee..eee...........hhhh...hhhhh.............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------N-------------T-T-----------------D--------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------LIPOCALIN     --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.4a       Exon 2.5a  PDB: F:20-65 UniProt: 38-83        -----------------------------------Exon 2.8a  PDB: F:101-172 UniProt: 119-190                              -- Transcript 2 (1)
           Transcript 2 (2) -------------------------------------------------------------Exon 2.6  PDB: F:65-101              ----------------------------------------------------------------------2.9 Transcript 2 (2)
                 1qab F   4 CAVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVAQRQEELCLAAQYRLIVHNGYC 174
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 6)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 6)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1QAB)

(-) Gene Ontology  (45, 54)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (TTHY_HUMAN | P02766)
molecular function
    GO:0005179    hormone activity    The action characteristic of a hormone, any substance formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells in the same organism, upon which it has a specific regulatory action. The term was originally applied to agents with a stimulatory physiological action in vertebrate animals (as opposed to a chalone, which has a depressant action). Usage is now extended to regulatory compounds in lower animals and plants, and to synthetic substances having comparable effects; all bind receptors and trigger some biological process.
    GO:0042562    hormone binding    Interacting selectively and non-covalently with any hormone, naturally occurring substances secreted by specialized cells that affect the metabolism or behavior of other cells possessing functional receptors for the hormone.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
biological process
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0030198    extracellular matrix organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
    GO:0001523    retinoid metabolic process    The chemical reactions and pathways involving retinoids, any member of a class of isoprenoids that contain or are derived from four prenyl groups linked head-to-tail. Retinoids include retinol and retinal and structurally similar natural derivatives or synthetic compounds, but need not have vitamin A activity.
    GO:0042572    retinol metabolic process    The chemical reactions and pathways involving retinol, one of the three compounds that makes up vitamin A.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Chain E,F   (RET4_HUMAN | P02753)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0016918    retinal binding    Interacting selectively and non-covalently with retinal, one of the forms of vitamin A. Retinal plays an important role in the visual process in most vertebrates, combining with opsins to form visual pigments in the retina.
    GO:0005501    retinoid binding    Interacting selectively and non-covalently with retinoids, any member of a class of isoprenoids that contain or are derived from four prenyl groups linked head-to-tail. Retinoids include retinol and retinal and structurally similar natural derivatives or synthetic compounds, but need not have vitamin A activity.
    GO:0019841    retinol binding    Interacting selectively and non-covalently with retinol, vitamin A1, 2,6,6-trimethyl-1-(9'-hydroxy-3',7'-dimethylnona-1',3',5',7'-tetraenyl)cyclohex-1-ene, one of the three components that makes up vitamin A. Retinol is an intermediate in the vision cycle and it also plays a role in growth and differentiation.
    GO:0034632    retinol transporter activity    Enables the directed movement of retinol into, out of or within a cell, or between cells. Retinol is vitamin A1, 2,6,6-trimethyl-1-(9'-hydroxy-3',7'-dimethylnona-1',3',5',7'-tetraenyl)cyclohex-1-ene, one of the three components that makes up vitamin A.
    GO:0036094    small molecule binding    Interacting selectively and non-covalently with a small molecule, any low molecular weight, monomeric, non-encoded molecule.
    GO:0005215    transporter activity    Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
    GO:0048738    cardiac muscle tissue development    The process whose specific outcome is the progression of cardiac muscle over time, from its formation to the mature structure.
    GO:0048562    embryonic organ morphogenesis    Morphogenesis, during the embryonic phase, of a tissue or tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
    GO:0060059    embryonic retina morphogenesis in camera-type eye    The process in which the anatomical structure of the retina is generated and organized in a camera-type eye during the embryonic life stage.
    GO:0048706    embryonic skeletal system development    The process, occurring during the embryonic phase, whose specific outcome is the progression of the skeleton over time, from its formation to the mature structure.
    GO:0001654    eye development    The process whose specific outcome is the progression of the eye over time, from its formation to the mature structure. The eye is the organ of sight.
    GO:0048807    female genitalia morphogenesis    The process in which the anatomical structures of female genitalia are generated and organized.
    GO:0006094    gluconeogenesis    The formation of glucose from noncarbohydrate precursors, such as pyruvate, amino acids and glycerol.
    GO:0042593    glucose homeostasis    Any process involved in the maintenance of an internal steady state of glucose within an organism or cell.
    GO:0007507    heart development    The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:0060347    heart trabecula formation    The process of creating a trabecula in the heart. A trabecula is a tissue element in the form of a small beam, strut or rod.
    GO:0030324    lung development    The process whose specific outcome is the progression of the lung over time, from its formation to the mature structure. In all air-breathing vertebrates the lungs are developed from the ventral wall of the oesophagus as a pouch which divides into two sacs. In amphibians and many reptiles the lungs retain very nearly this primitive sac-like character, but in the higher forms the connection with the esophagus becomes elongated into the windpipe and the inner walls of the sacs become more and more divided, until, in the mammals, the air spaces become minutely divided into tubes ending in small air cells, in the walls of which the blood circulates in a fine network of capillaries. In mammals the lungs are more or less divided into lobes, and each lung occupies a separate cavity in the thorax.
    GO:0030277    maintenance of gastrointestinal epithelium    Protection of epithelial surfaces of the gastrointestinal tract from proteolytic and caustic digestive agents.
    GO:0060044    negative regulation of cardiac muscle cell proliferation    Any process that stops, prevents, or reduces the frequency, rate or extent of cardiac muscle cell proliferation.
    GO:0051024    positive regulation of immunoglobulin secretion    Any process that activates or increases the frequency, rate or extent of the regulated release of immunoglobulins from a cell.
    GO:0032024    positive regulation of insulin secretion    Any process that activates or increases the frequency, rate or extent of the regulated release of insulin.
    GO:0045471    response to ethanol    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
    GO:0032526    response to retinoic acid    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a retinoic acid stimulus.
    GO:0050896    response to stimulus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus. The process begins with detection of the stimulus and ends with a change in state or activity or the cell or organism.
    GO:0001523    retinoid metabolic process    The chemical reactions and pathways involving retinoids, any member of a class of isoprenoids that contain or are derived from four prenyl groups linked head-to-tail. Retinoids include retinol and retinal and structurally similar natural derivatives or synthetic compounds, but need not have vitamin A activity.
    GO:0042572    retinol metabolic process    The chemical reactions and pathways involving retinol, one of the three compounds that makes up vitamin A.
    GO:0034633    retinol transport    The directed movement of retinol into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Retinol is vitamin A1, 2,6,6-trimethyl-1-(9'-hydroxy-3',7'-dimethylnona-1',3',5',7'-tetraenyl)cyclohex-1-ene, one of the three components that makes up vitamin A.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0060157    urinary bladder development    The process whose specific outcome is the progression of the urinary bladder over time, from its formation to the mature structure. The urinary bladder is an elastic, muscular sac situated in the anterior part of the pelvic cavity in which urine collects before excretion.
    GO:0060065    uterus development    The reproductive developmental process whose specific outcome is the progression of the uterus over time, from its formation to the mature structure.
    GO:0060068    vagina development    The reproductive developmental process whose specific outcome is the progression of the vagina over time, from its formation to the mature structure.
    GO:0007601    visual perception    The series of events required for an organism to receive a visual stimulus, convert it to a molecular signal, and recognize and characterize the signal. Visual stimuli are detected in the form of photons and are processed to form an image.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    RTL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qab)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1qab
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RET4_HUMAN | P02753
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  TTHY_HUMAN | P02766
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  105210
    Disease InformationOMIM
  115430
    Disease InformationOMIM
  145680
    Disease InformationOMIM
  615147
    Disease InformationOMIM
  616428
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RET4_HUMAN | P02753
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TTHY_HUMAN | P02766
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RET4_HUMAN | P027531brp 1brq 1jyd 1jyj 1rbp 1rlb 2wq9 2wqa 2wr6 3bsz 3fmz 4o9s 4psq
        TTHY_HUMAN | P027661bm7 1bmz 1bz8 1bzd 1bze 1dvq 1dvs 1dvt 1dvu 1dvx 1dvy 1dvz 1e3f 1e4h 1e5a 1eta 1etb 1f41 1f64 1f86 1fh2 1fhn 1g1o 1gko 1ict 1iii 1iik 1ijn 1qwh 1rlb 1sok 1soq 1tha 1thc 1tlm 1tsh 1tt6 1tta 1ttb 1ttc 1ttr 1tyr 1tz8 1u21 1x7s 1x7t 1y1d 1z7j 1zcr 1zd6 2b14 2b15 2b16 2b77 2b9a 2f7i 2f8i 2fbr 2flm 2g3x 2g3z 2g4e 2g4g 2g5u 2g9k 2gab 2h4e 2m5n 2nbo 2nbp 2noy 2pab 2qel 2qgb 2qgc 2qgd 2qge 2rox 2roy 2trh 2try 2wqa 3a4d 3a4e 3a4f 3b56 3bsz 3bt0 3cbr 3cfm 3cfn 3cfq 3cft 3cn0 3cn1 3cn2 3cn3 3cn4 3cxf 3d2t 3d7p 3dgd 3did 3djr 3djs 3djt 3djz 3dk0 3dk2 3do4 3esn 3eso 3esp 3fc8 3fcb 3glz 3gps 3grb 3grg 3gs0 3gs4 3gs7 3hj0 3i9a 3i9i 3i9p 3imr 3ims 3imt 3imu 3imv 3imw 3ipb 3ipe 3kgs 3kgt 3kgu 3m1o 3nee 3neo 3nes 3nex 3ng5 3ozk 3ozl 3p3r 3p3s 3p3t 3p3u 3ssg 3tct 3tfb 3u2i 3u2j 3w3b 4abq 4abu 4abv 4abw 4ac2 4ac4 4act 4ank 4d7b 4der 4des 4det 4deu 4dew 4fi6 4fi7 4fi8 4hiq 4his 4hjs 4hjt 4hju 4i85 4i87 4i89 4iiz 4ik6 4ik7 4iki 4ikj 4ikk 4ikl 4ky2 4l1s 4l1t 4mas 4mrb 4mrc 4n85 4n86 4n87 4pm1 4pme 4pmf 4pvl 4pvm 4pvn 4pwe 4pwf 4pwg 4pwh 4pwi 4pwj 4pwk 4qrf 4qxv 4qya 4tkw 4tl4 4tl5 4tlk 4tls 4tlt 4tlu 4tm9 4tne 4tnf 4tng 4tq8 4tqh 4tqi 4tqp 4wnj 4wns 4wo0 4y9b 4y9c 4y9e 4y9f 4y9g 4ydm 4ydn 5a6i 5aks 5akt 5akv 5al0 5al8 5ayt 5boj 5clx 5cly 5clz 5cm1 5cn3 5cnh 5cr1 5dej 5dwp 5e23 5e4a 5e4o 5en3 5ezp 5fo2 5fw6 5fw7 5fw8 5h0v 5h0w 5h0x 5h0y 5h0z 5hjg 5ihh 5jid 5jim 5jiq 5k1j 5k1n 5l4f 5l4i 5l4j 5l4m 5lll 5llv 5ttr 5tzl

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1QAB)