Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF RETINOL-BINDING PROTEIN 4 (RBP4) IN COMPLEX WITH NON-RETINOID LIGAND
 
Authors :  Z. Wang, S. Johnstone, N. P. Walker
Date :  22 Dec 08  (Deposition) - 27 Jan 09  (Release) - 31 Mar 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Retinol Binding, Disease Mutation, Retinol-Binding, Secreted, Sensory Transduction, Transport, Vision, Vitamin A, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Motani, Z. Wang, M. Conn, K. Siegler, Y. Zhang, Q. Liu, S. Johnstone, H. Xu, S. Thibault, Y. Wang, P. Fan, R. Connors, H. Le, G. Xu, N. Walker, B. Shan, P. Coward
Identification And Characterization Of A Non-Retinoid Ligand For Retinol-Binding Protein 4 Which Lowers Serum Retinol-Binding Protein 4 Levels In Vivo.
J. Biol. Chem. V. 284 7673 2009
PubMed-ID: 19147488  |  Reference-DOI: 10.1074/JBC.M809654200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - RETINOL-BINDING PROTEIN 4
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET21A
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneRBP4, PRO2222
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPLASMA RETINOL-BINDING PROTEIN, PRBP, RBP

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
12T12Ligand/Ion2-[({4-[2-(TRIFLUOROMETHYL)PHENYL]PIPERIDIN-1-YL}CARBONYL)AMINO]BENZOIC ACID
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
12T11Ligand/Ion2-[({4-[2-(TRIFLUOROMETHYL)PHENYL]PIPERIDIN-1-YL}CARBONYL)AMINO]BENZOIC ACID
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
12T11Ligand/Ion2-[({4-[2-(TRIFLUOROMETHYL)PHENYL]PIPERIDIN-1-YL}CARBONYL)AMINO]BENZOIC ACID

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:35 , PHE A:36 , LEU A:37 , ALA A:57 , MET A:73 , GLY A:75 , MET A:88 , TYR A:90 , GLN A:98 , HIS A:104 , ARG A:121 , TYR A:133 , PHE A:135BINDING SITE FOR RESIDUE 2T1 A 184
2AC2SOFTWARELEU B:35 , PHE B:36 , LEU B:37 , ALA B:55 , MET B:73 , MET B:88 , TYR B:90 , GLN B:98 , HIS B:104 , GLN B:117 , ARG B:121 , PHE B:135BINDING SITE FOR RESIDUE 2T1 B 184

(-) SS Bonds  (6, 6)

Asymmetric Unit
No.Residues
1A:4 -A:160
2A:70 -A:174
3A:120 -A:129
4B:4 -B:160
5B:70 -B:174
6B:120 -B:129

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3FMZ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (4, 8)

Asymmetric Unit (4, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_009276I59NRET4_HUMANDisease (RDCCAS)121918584A/BI41N
2UniProtVAR_073856A73TRET4_HUMANDisease (MCOPCB10)794726862A/BA55T
3UniProtVAR_073857A75TRET4_HUMANDisease (MCOPCB10)794726861A/BA57T
4UniProtVAR_009277G93DRET4_HUMANDisease (RDCCAS)121918585A/BG75D

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_009276I59NRET4_HUMANDisease (RDCCAS)121918584AI41N
2UniProtVAR_073856A73TRET4_HUMANDisease (MCOPCB10)794726862AA55T
3UniProtVAR_073857A75TRET4_HUMANDisease (MCOPCB10)794726861AA57T
4UniProtVAR_009277G93DRET4_HUMANDisease (RDCCAS)121918585AG75D

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_009276I59NRET4_HUMANDisease (RDCCAS)121918584BI41N
2UniProtVAR_073856A73TRET4_HUMANDisease (MCOPCB10)794726862BA55T
3UniProtVAR_073857A75TRET4_HUMANDisease (MCOPCB10)794726861BA57T
4UniProtVAR_009277G93DRET4_HUMANDisease (RDCCAS)121918585BG75D

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LIPOCALINPS00213 Lipocalin signature.RET4_HUMAN32-45
 
  2A:14-27
B:14-27
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LIPOCALINPS00213 Lipocalin signature.RET4_HUMAN32-45
 
  1A:14-27
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LIPOCALINPS00213 Lipocalin signature.RET4_HUMAN32-45
 
  1-
B:14-27

(-) Exons   (5, 10)

Asymmetric Unit (5, 10)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2aENST000003714672aENSE00001455291chr10:95361420-95361119302RET4_HUMAN-00--
1.4aENST000003714674aENSE00001455290chr10:95360803-95360675129RET4_HUMAN1-37372A:1-19
B:1-19
19
19
1.5aENST000003714675aENSE00000932979chr10:95360560-95360424137RET4_HUMAN38-83462A:20-65
B:20-65
46
46
1.6ENST000003714676ENSE00000932978chr10:95360256-95360150107RET4_HUMAN83-119372A:65-101
B:65-101
37
37
1.8aENST000003714678aENSE00000932977chr10:95353792-95353580213RET4_HUMAN119-190722A:101-172
B:101-172
72
72
1.9cENST000003714679cENSE00001455294chr10:95351869-95351444426RET4_HUMAN190-201122A:172-174
B:172-174
3
3

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:174
 aligned with RET4_HUMAN | P02753 from UniProtKB/Swiss-Prot  Length:201

    Alignment length:174
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188    
           RET4_HUMAN    19 ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYC 192
               SCOP domains d3fmza_ A: automated matches                                                                                                                                                   SCOP domains
               CATH domains 3fmzA00 A:1-174  [code=2.40.128.20, no name defined]                                                                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhh......hhhhhheeeeeeeee........eeeeeeeee.....eeeeeeeeeee...eeeeeeeeeeee......eeeeeeee......eeeeeeeeeee....eeeeeeeeee.....eeeeeeeeee......hhhhhhhhhhhhhhh......ee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------N-------------T-T-----------------D--------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------LIPOCALIN     --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4a          Exon 1.5a  PDB: A:20-65 UniProt: 38-83        -----------------------------------Exon 1.8a  PDB: A:101-172 UniProt: 119-190                              -- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------Exon 1.6  PDB: A:65-101              ----------------------------------------------------------------------1.9 Transcript 1 (2)
                 3fmz A   1 ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYC 174
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170    

Chain B from PDB  Type:PROTEIN  Length:174
 aligned with RET4_HUMAN | P02753 from UniProtKB/Swiss-Prot  Length:201

    Alignment length:174
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188    
           RET4_HUMAN    19 ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYC 192
               SCOP domains d3fmzb_ B: automated matches                                                                                                                                                   SCOP domains
               CATH domains 3fmzB00 B:1-174  [code=2.40.128.20, no name defined]                                                                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhh......hhhhhheeeeeeeee........eeeeeeeee.....eeeeeeeeee.....eeeeeeeeeeee.....eeeeeeee......eeeeeeeeeee....eeeeeeeeee.....eeeeeeeeee......hhhhhhhhhhhhhhh......ee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------N-------------T-T-----------------D--------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------LIPOCALIN     --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4a          Exon 1.5a  PDB: B:20-65 UniProt: 38-83        -----------------------------------Exon 1.8a  PDB: B:101-172 UniProt: 119-190                              -- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------Exon 1.6  PDB: B:65-101              ----------------------------------------------------------------------1.9 Transcript 1 (2)
                 3fmz B   1 ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYC 174
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3FMZ)

(-) Gene Ontology  (39, 39)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (RET4_HUMAN | P02753)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0016918    retinal binding    Interacting selectively and non-covalently with retinal, one of the forms of vitamin A. Retinal plays an important role in the visual process in most vertebrates, combining with opsins to form visual pigments in the retina.
    GO:0005501    retinoid binding    Interacting selectively and non-covalently with retinoids, any member of a class of isoprenoids that contain or are derived from four prenyl groups linked head-to-tail. Retinoids include retinol and retinal and structurally similar natural derivatives or synthetic compounds, but need not have vitamin A activity.
    GO:0019841    retinol binding    Interacting selectively and non-covalently with retinol, vitamin A1, 2,6,6-trimethyl-1-(9'-hydroxy-3',7'-dimethylnona-1',3',5',7'-tetraenyl)cyclohex-1-ene, one of the three components that makes up vitamin A. Retinol is an intermediate in the vision cycle and it also plays a role in growth and differentiation.
    GO:0034632    retinol transporter activity    Enables the directed movement of retinol into, out of or within a cell, or between cells. Retinol is vitamin A1, 2,6,6-trimethyl-1-(9'-hydroxy-3',7'-dimethylnona-1',3',5',7'-tetraenyl)cyclohex-1-ene, one of the three components that makes up vitamin A.
    GO:0036094    small molecule binding    Interacting selectively and non-covalently with a small molecule, any low molecular weight, monomeric, non-encoded molecule.
    GO:0005215    transporter activity    Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
    GO:0048738    cardiac muscle tissue development    The process whose specific outcome is the progression of cardiac muscle over time, from its formation to the mature structure.
    GO:0048562    embryonic organ morphogenesis    Morphogenesis, during the embryonic phase, of a tissue or tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
    GO:0060059    embryonic retina morphogenesis in camera-type eye    The process in which the anatomical structure of the retina is generated and organized in a camera-type eye during the embryonic life stage.
    GO:0048706    embryonic skeletal system development    The process, occurring during the embryonic phase, whose specific outcome is the progression of the skeleton over time, from its formation to the mature structure.
    GO:0001654    eye development    The process whose specific outcome is the progression of the eye over time, from its formation to the mature structure. The eye is the organ of sight.
    GO:0048807    female genitalia morphogenesis    The process in which the anatomical structures of female genitalia are generated and organized.
    GO:0006094    gluconeogenesis    The formation of glucose from noncarbohydrate precursors, such as pyruvate, amino acids and glycerol.
    GO:0042593    glucose homeostasis    Any process involved in the maintenance of an internal steady state of glucose within an organism or cell.
    GO:0007507    heart development    The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:0060347    heart trabecula formation    The process of creating a trabecula in the heart. A trabecula is a tissue element in the form of a small beam, strut or rod.
    GO:0030324    lung development    The process whose specific outcome is the progression of the lung over time, from its formation to the mature structure. In all air-breathing vertebrates the lungs are developed from the ventral wall of the oesophagus as a pouch which divides into two sacs. In amphibians and many reptiles the lungs retain very nearly this primitive sac-like character, but in the higher forms the connection with the esophagus becomes elongated into the windpipe and the inner walls of the sacs become more and more divided, until, in the mammals, the air spaces become minutely divided into tubes ending in small air cells, in the walls of which the blood circulates in a fine network of capillaries. In mammals the lungs are more or less divided into lobes, and each lung occupies a separate cavity in the thorax.
    GO:0030277    maintenance of gastrointestinal epithelium    Protection of epithelial surfaces of the gastrointestinal tract from proteolytic and caustic digestive agents.
    GO:0060044    negative regulation of cardiac muscle cell proliferation    Any process that stops, prevents, or reduces the frequency, rate or extent of cardiac muscle cell proliferation.
    GO:0051024    positive regulation of immunoglobulin secretion    Any process that activates or increases the frequency, rate or extent of the regulated release of immunoglobulins from a cell.
    GO:0032024    positive regulation of insulin secretion    Any process that activates or increases the frequency, rate or extent of the regulated release of insulin.
    GO:0045471    response to ethanol    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
    GO:0032526    response to retinoic acid    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a retinoic acid stimulus.
    GO:0050896    response to stimulus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus. The process begins with detection of the stimulus and ends with a change in state or activity or the cell or organism.
    GO:0001523    retinoid metabolic process    The chemical reactions and pathways involving retinoids, any member of a class of isoprenoids that contain or are derived from four prenyl groups linked head-to-tail. Retinoids include retinol and retinal and structurally similar natural derivatives or synthetic compounds, but need not have vitamin A activity.
    GO:0042572    retinol metabolic process    The chemical reactions and pathways involving retinol, one of the three compounds that makes up vitamin A.
    GO:0034633    retinol transport    The directed movement of retinol into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Retinol is vitamin A1, 2,6,6-trimethyl-1-(9'-hydroxy-3',7'-dimethylnona-1',3',5',7'-tetraenyl)cyclohex-1-ene, one of the three components that makes up vitamin A.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0060157    urinary bladder development    The process whose specific outcome is the progression of the urinary bladder over time, from its formation to the mature structure. The urinary bladder is an elastic, muscular sac situated in the anterior part of the pelvic cavity in which urine collects before excretion.
    GO:0060065    uterus development    The reproductive developmental process whose specific outcome is the progression of the uterus over time, from its formation to the mature structure.
    GO:0060068    vagina development    The reproductive developmental process whose specific outcome is the progression of the vagina over time, from its formation to the mature structure.
    GO:0007601    visual perception    The series of events required for an organism to receive a visual stimulus, convert it to a molecular signal, and recognize and characterize the signal. Visual stimuli are detected in the form of photons and are processed to form an image.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2T1  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3fmz)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3fmz
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RET4_HUMAN | P02753
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  615147
    Disease InformationOMIM
  616428
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RET4_HUMAN | P02753
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RET4_HUMAN | P027531brp 1brq 1jyd 1jyj 1qab 1rbp 1rlb 2wq9 2wqa 2wr6 3bsz 4o9s 4psq

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3FMZ)