Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  HUMAN TRANSTHYRETIN (TTR) COMPLEXED WITH DIFLUNISAL
 
Authors :  S. K. Palaninathan, J. W. Kelly, J. C. Sacchettini
Date :  08 May 08  (Deposition) - 20 May 08  (Release) - 07 Aug 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.85
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Ttr, Amyloid, Transthyretin, Disease Mutation, Gamma-Carboxyglutamic Acid, Glycoprotein, Hormone, Polyneuropathy, Retinol-Binding, Secreted, Thyroid Hormone, Transport, Vitamin A, Hormone-Growth Factor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. L. Adamski-Werner, S. K. Palaninathan, J. C. Sacchettini, J. W. Kelly
Diflunisal Analogues Stabilize The Native State Of Transthyretin. Potent Inhibition Of Amyloidogenesis.
J. Med. Chem. V. 47 355 2004
PubMed-ID: 14711308  |  Reference-DOI: 10.1021/JM030347N

(-) Compounds

Molecule 1 - TRANSTHYRETIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneTTR, PALB
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPREALBUMIN, TBPA, TTR, ATTR

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
11FL2Ligand/Ion5-(2,4-DIFLUOROPHENYL)-2-HYDROXY-BENZOIC ACID
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
11FL4Ligand/Ion5-(2,4-DIFLUOROPHENYL)-2-HYDROXY-BENZOIC ACID

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELYS B:15 , LEU B:17 , ALA B:108 , ALA B:109 , LEU B:110 , SER B:117 , THR B:118 , THR B:119BINDING SITE FOR RESIDUE 1FL B 500
2AC2SOFTWARELYS A:15 , LEU A:17 , ALA A:108 , ALA A:109 , LEU A:110 , SER A:117 , THR A:118 , THR A:119BINDING SITE FOR RESIDUE 1FL A 502

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3D2T)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3D2T)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (86, 169)

Asymmetric Unit (86, 169)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_007547C30RTTHY_HUMANDisease (AMYL-TTR)121918083A/BC10R
02UniProtVAR_038959L32PTTHY_HUMANDisease (AMYL-TTR)121918094A/BL12P
03UniProtVAR_038960M33ITTHY_HUMANPolymorphism  ---A/BM13I
04UniProtVAR_007548D38ETTHY_HUMANDisease (AMYL-TTR)  ---A/BD18E
05UniProtVAR_007549D38GTTHY_HUMANDisease (AMYL-TTR)121918098A/BD18G
06UniProtVAR_007550V40ITTHY_HUMANDisease (AMYL-TTR)121918093A/BV20I
07UniProtVAR_038961S43NTTHY_HUMANDisease (AMYL-TTR)  ---A/BS23N
08UniProtVAR_007551P44STTHY_HUMANDisease (AMYL-TTR)11541790A/BP24S
09UniProtVAR_010658V48MTTHY_HUMANDisease (AMYL-TTR)  ---A/BV28M
10UniProtVAR_007552V50ATTHY_HUMANDisease (AMYL-TTR)79977247A/BV30A
11UniProtVAR_038962V50GTTHY_HUMANDisease (AMYL-TTR)79977247A/BV30G
12UniProtVAR_007553V50LTTHY_HUMANDisease (AMYL-TTR)28933979A/BV30L
13UniProtVAR_007554V50MTTHY_HUMANDisease (AMYL-TTR)28933979A/BV30M
14UniProtVAR_038963F53CTTHY_HUMANUnclassified  ---A/BF33C
15UniProtVAR_007555F53ITTHY_HUMANDisease (AMYL-TTR)121918068A/BF33I
16UniProtVAR_007556F53LTTHY_HUMANDisease (AMYL-TTR)121918068A/BF33L
17UniProtVAR_038964F53VTTHY_HUMANDisease (AMYL-TTR)  ---A/BF33V
18UniProtVAR_038965R54TTTHY_HUMANDisease (AMYL-TTR)  ---A/BR34T
19UniProtVAR_038966K55NTTHY_HUMANDisease (AMYL-TTR)  ---A/BK35N
20UniProtVAR_007557A56PTTHY_HUMANDisease (AMYL-TTR)121918077A/BA36P
21UniProtVAR_038967D58ATTHY_HUMANDisease (AMYL-TTR)  ---A/BD38A
22UniProtVAR_038968D58VTTHY_HUMANDisease (AMYL-TTR)  ---A/BD38V
23UniProtVAR_038969W61LTTHY_HUMANDisease (AMYL-TTR)  ---A/BW41L
24UniProtVAR_038970E62DTTHY_HUMANDisease (AMYL-TTR)11541796A/BE42D
25UniProtVAR_007558E62GTTHY_HUMANDisease (AMYL-TTR)11541796A/BE42G
26UniProtVAR_038971F64STTHY_HUMANDisease (AMYL-TTR)104894665A/BF44S
27UniProtVAR_007559A65DTTHY_HUMANDisease (AMYL-TTR)730881169A/BA45D
28UniProtVAR_038972A65STTHY_HUMANDisease (AMYL-TTR)  ---A/BA45S
29UniProtVAR_007560A65TTTHY_HUMANDisease (AMYL-TTR)121918078A/BA45T
30UniProtVAR_007561G67ATTHY_HUMANDisease (AMYL-TTR)121918090A/BG47A
31UniProtVAR_038973G67ETTHY_HUMANDisease (AMYL-TTR)  ---A/BG47E
32UniProtVAR_007562G67RTTHY_HUMANDisease (AMYL-TTR)387906523A/BG47R
33UniProtVAR_007563G67VTTHY_HUMANDisease (AMYL-TTR)  ---A/BG47V
34UniProtVAR_007564T69ATTHY_HUMANDisease (AMYL-TTR)121918081A/BT49A
35UniProtVAR_038974T69ITTHY_HUMANDisease (AMYL-TTR)  ---A/BT49I
36UniProtVAR_007565S70ITTHY_HUMANDisease (AMYL-TTR)121918080A/BS50I
37UniProtVAR_007566S70RTTHY_HUMANDisease (AMYL-TTR)386134269A/BS50R
38UniProtVAR_007567S72PTTHY_HUMANDisease (AMYL-TTR)  ---A/BS52P
39UniProtVAR_038975G73ETTHY_HUMANDisease (AMYL-TTR)121918097A/BG53E
40UniProtVAR_007568E74GTTHY_HUMANDisease (AMYL-TTR)  ---A/BE54G
41UniProtVAR_038976E74KTTHY_HUMANDisease (AMYL-TTR)  ---A/BE54K
42UniProtVAR_007569L75PTTHY_HUMANDisease (AMYL-TTR)121918079A/BL55P
43UniProtVAR_038977L75QTTHY_HUMANDisease (AMYL-TTR)  ---A/BL55Q
44UniProtVAR_007570L78HTTHY_HUMANDisease (AMYL-TTR)121918069A/BL58H
45UniProtVAR_007571L78RTTHY_HUMANDisease (AMYL-TTR)121918069A/BL58R
46UniProtVAR_007572T79KTTHY_HUMANDisease (AMYL-TTR)730881163A/BT59K
47UniProtVAR_007573T80ATTHY_HUMANDisease (AMYL-TTR)121918070A/BT60A
48UniProtVAR_038978E81GTTHY_HUMANDisease (AMYL-TTR)  ---A/BE61G
49UniProtVAR_007574E81KTTHY_HUMANDisease (AMYL-TTR)121918086A/BE61K
50UniProtVAR_007575F84LTTHY_HUMANDisease (AMYL-TTR)121918091A/BF64L
51UniProtVAR_007576I88LTTHY_HUMANDisease (AMYL-TTR)121918085A/BI68L
52UniProtVAR_007577Y89HTTHY_HUMANDisease (AMYL-TTR)121918100A/BY69H
53UniProtVAR_007578K90NTTHY_HUMANDisease (AMYL-TTR)267607160A/BK70N
54UniProtVAR_007579V91ATTHY_HUMANDisease (AMYL-TTR)121918084A/BV71A
55UniProtVAR_007580I93VTTHY_HUMANDisease (AMYL-TTR)  ---A/BI73V
56UniProtVAR_007581D94HTTHY_HUMANPolymorphism730881164A/BD74H
57UniProtVAR_007582S97YTTHY_HUMANDisease (AMYL-TTR)121918071A/BS77Y
58UniProtVAR_038979Y98FTTHY_HUMANDisease (AMYL-TTR)  ---A/BY78F
59UniProtVAR_007583I104NTTHY_HUMANDisease (AMYL-TTR)  ---A/BI84N
60UniProtVAR_007584I104STTHY_HUMANDisease (AMYL-TTR)121918072A/BI84S
61UniProtVAR_038980I104TTTHY_HUMANDisease (AMYL-TTR)  ---A/BI84T
62UniProtVAR_010659E109KTTHY_HUMANDisease (AMYL-TTR)  ---A/BE89K
63UniProtVAR_007585E109QTTHY_HUMANDisease (AMYL-TTR)121918082A/BE89Q
64UniProtVAR_007586H110NTTHY_HUMANPolymorphism121918074A/BH90N
65UniProtVAR_007587A111STTHY_HUMANDisease (AMYL-TTR)  ---A/BA91S
66UniProtVAR_038981V114ATTHY_HUMANUnclassified  ---A/BV94A
67UniProtVAR_007588A117GTTHY_HUMANDisease (AMYL-TTR)121918087A/BA97G
68UniProtVAR_038982A117STTHY_HUMANDisease (AMYL-TTR)267607161A/BA97S
69UniProtVAR_007589G121STTHY_HUMANPolymorphism755337715AG101S
70UniProtVAR_007590P122RTTHY_HUMANPolymorphism  ---AP102R
71UniProtVAR_007591R124CTTHY_HUMANPolymorphism745834030A/BR104C
72UniProtVAR_038983R124HTTHY_HUMANPolymorphism121918095A/BR104H
73UniProtVAR_038984T126NTTHY_HUMANDisease (AMYL-TTR)  ---A/BT106N
74UniProtVAR_038985I127MTTHY_HUMANDisease (AMYL-TTR)  ---A/BI107M
75UniProtVAR_007592I127VTTHY_HUMANDisease (AMYL-TTR)121918089A/BI107V
76UniProtVAR_007593A129TTTHY_HUMANDisease (DTTRH)267607159A/BA109T
77UniProtVAR_007594L131MTTHY_HUMANDisease (AMYL-TTR)121918073A/BL111M
78UniProtVAR_007595Y134CTTHY_HUMANDisease (AMYL-TTR)121918075A/BY114C
79UniProtVAR_007598Y134HTTHY_HUMANDisease (CTS1)121918088A/BY114H
80UniProtVAR_007596Y136STTHY_HUMANDisease (AMYL-TTR)730881167A/BY116S
81UniProtVAR_007597Y136VTTHY_HUMANUnclassified  ---A/BY116V
82UniProtVAR_007599T139MTTHY_HUMANPolymorphism28933981A/BT119M
83UniProtVAR_038986A140STTHY_HUMANDisease (AMYL-TTR)876658108A/BA120S
84UniProtVAR_038987V142ATTHY_HUMANDisease (AMYL-TTR)  ---A/BV122A
85UniProtVAR_007600V142ITTHY_HUMANDisease (AMYL-TTR)28933980A/BV122I
86UniProtVAR_038988N144STTHY_HUMANDisease (AMYL-TTR)144965179AN124S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (86, 338)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_007547C30RTTHY_HUMANDisease (AMYL-TTR)121918083A/BC10R
02UniProtVAR_038959L32PTTHY_HUMANDisease (AMYL-TTR)121918094A/BL12P
03UniProtVAR_038960M33ITTHY_HUMANPolymorphism  ---A/BM13I
04UniProtVAR_007548D38ETTHY_HUMANDisease (AMYL-TTR)  ---A/BD18E
05UniProtVAR_007549D38GTTHY_HUMANDisease (AMYL-TTR)121918098A/BD18G
06UniProtVAR_007550V40ITTHY_HUMANDisease (AMYL-TTR)121918093A/BV20I
07UniProtVAR_038961S43NTTHY_HUMANDisease (AMYL-TTR)  ---A/BS23N
08UniProtVAR_007551P44STTHY_HUMANDisease (AMYL-TTR)11541790A/BP24S
09UniProtVAR_010658V48MTTHY_HUMANDisease (AMYL-TTR)  ---A/BV28M
10UniProtVAR_007552V50ATTHY_HUMANDisease (AMYL-TTR)79977247A/BV30A
11UniProtVAR_038962V50GTTHY_HUMANDisease (AMYL-TTR)79977247A/BV30G
12UniProtVAR_007553V50LTTHY_HUMANDisease (AMYL-TTR)28933979A/BV30L
13UniProtVAR_007554V50MTTHY_HUMANDisease (AMYL-TTR)28933979A/BV30M
14UniProtVAR_038963F53CTTHY_HUMANUnclassified  ---A/BF33C
15UniProtVAR_007555F53ITTHY_HUMANDisease (AMYL-TTR)121918068A/BF33I
16UniProtVAR_007556F53LTTHY_HUMANDisease (AMYL-TTR)121918068A/BF33L
17UniProtVAR_038964F53VTTHY_HUMANDisease (AMYL-TTR)  ---A/BF33V
18UniProtVAR_038965R54TTTHY_HUMANDisease (AMYL-TTR)  ---A/BR34T
19UniProtVAR_038966K55NTTHY_HUMANDisease (AMYL-TTR)  ---A/BK35N
20UniProtVAR_007557A56PTTHY_HUMANDisease (AMYL-TTR)121918077A/BA36P
21UniProtVAR_038967D58ATTHY_HUMANDisease (AMYL-TTR)  ---A/BD38A
22UniProtVAR_038968D58VTTHY_HUMANDisease (AMYL-TTR)  ---A/BD38V
23UniProtVAR_038969W61LTTHY_HUMANDisease (AMYL-TTR)  ---A/BW41L
24UniProtVAR_038970E62DTTHY_HUMANDisease (AMYL-TTR)11541796A/BE42D
25UniProtVAR_007558E62GTTHY_HUMANDisease (AMYL-TTR)11541796A/BE42G
26UniProtVAR_038971F64STTHY_HUMANDisease (AMYL-TTR)104894665A/BF44S
27UniProtVAR_007559A65DTTHY_HUMANDisease (AMYL-TTR)730881169A/BA45D
28UniProtVAR_038972A65STTHY_HUMANDisease (AMYL-TTR)  ---A/BA45S
29UniProtVAR_007560A65TTTHY_HUMANDisease (AMYL-TTR)121918078A/BA45T
30UniProtVAR_007561G67ATTHY_HUMANDisease (AMYL-TTR)121918090A/BG47A
31UniProtVAR_038973G67ETTHY_HUMANDisease (AMYL-TTR)  ---A/BG47E
32UniProtVAR_007562G67RTTHY_HUMANDisease (AMYL-TTR)387906523A/BG47R
33UniProtVAR_007563G67VTTHY_HUMANDisease (AMYL-TTR)  ---A/BG47V
34UniProtVAR_007564T69ATTHY_HUMANDisease (AMYL-TTR)121918081A/BT49A
35UniProtVAR_038974T69ITTHY_HUMANDisease (AMYL-TTR)  ---A/BT49I
36UniProtVAR_007565S70ITTHY_HUMANDisease (AMYL-TTR)121918080A/BS50I
37UniProtVAR_007566S70RTTHY_HUMANDisease (AMYL-TTR)386134269A/BS50R
38UniProtVAR_007567S72PTTHY_HUMANDisease (AMYL-TTR)  ---A/BS52P
39UniProtVAR_038975G73ETTHY_HUMANDisease (AMYL-TTR)121918097A/BG53E
40UniProtVAR_007568E74GTTHY_HUMANDisease (AMYL-TTR)  ---A/BE54G
41UniProtVAR_038976E74KTTHY_HUMANDisease (AMYL-TTR)  ---A/BE54K
42UniProtVAR_007569L75PTTHY_HUMANDisease (AMYL-TTR)121918079A/BL55P
43UniProtVAR_038977L75QTTHY_HUMANDisease (AMYL-TTR)  ---A/BL55Q
44UniProtVAR_007570L78HTTHY_HUMANDisease (AMYL-TTR)121918069A/BL58H
45UniProtVAR_007571L78RTTHY_HUMANDisease (AMYL-TTR)121918069A/BL58R
46UniProtVAR_007572T79KTTHY_HUMANDisease (AMYL-TTR)730881163A/BT59K
47UniProtVAR_007573T80ATTHY_HUMANDisease (AMYL-TTR)121918070A/BT60A
48UniProtVAR_038978E81GTTHY_HUMANDisease (AMYL-TTR)  ---A/BE61G
49UniProtVAR_007574E81KTTHY_HUMANDisease (AMYL-TTR)121918086A/BE61K
50UniProtVAR_007575F84LTTHY_HUMANDisease (AMYL-TTR)121918091A/BF64L
51UniProtVAR_007576I88LTTHY_HUMANDisease (AMYL-TTR)121918085A/BI68L
52UniProtVAR_007577Y89HTTHY_HUMANDisease (AMYL-TTR)121918100A/BY69H
53UniProtVAR_007578K90NTTHY_HUMANDisease (AMYL-TTR)267607160A/BK70N
54UniProtVAR_007579V91ATTHY_HUMANDisease (AMYL-TTR)121918084A/BV71A
55UniProtVAR_007580I93VTTHY_HUMANDisease (AMYL-TTR)  ---A/BI73V
56UniProtVAR_007581D94HTTHY_HUMANPolymorphism730881164A/BD74H
57UniProtVAR_007582S97YTTHY_HUMANDisease (AMYL-TTR)121918071A/BS77Y
58UniProtVAR_038979Y98FTTHY_HUMANDisease (AMYL-TTR)  ---A/BY78F
59UniProtVAR_007583I104NTTHY_HUMANDisease (AMYL-TTR)  ---A/BI84N
60UniProtVAR_007584I104STTHY_HUMANDisease (AMYL-TTR)121918072A/BI84S
61UniProtVAR_038980I104TTTHY_HUMANDisease (AMYL-TTR)  ---A/BI84T
62UniProtVAR_010659E109KTTHY_HUMANDisease (AMYL-TTR)  ---A/BE89K
63UniProtVAR_007585E109QTTHY_HUMANDisease (AMYL-TTR)121918082A/BE89Q
64UniProtVAR_007586H110NTTHY_HUMANPolymorphism121918074A/BH90N
65UniProtVAR_007587A111STTHY_HUMANDisease (AMYL-TTR)  ---A/BA91S
66UniProtVAR_038981V114ATTHY_HUMANUnclassified  ---A/BV94A
67UniProtVAR_007588A117GTTHY_HUMANDisease (AMYL-TTR)121918087A/BA97G
68UniProtVAR_038982A117STTHY_HUMANDisease (AMYL-TTR)267607161A/BA97S
69UniProtVAR_007589G121STTHY_HUMANPolymorphism755337715AG101S
70UniProtVAR_007590P122RTTHY_HUMANPolymorphism  ---AP102R
71UniProtVAR_007591R124CTTHY_HUMANPolymorphism745834030A/BR104C
72UniProtVAR_038983R124HTTHY_HUMANPolymorphism121918095A/BR104H
73UniProtVAR_038984T126NTTHY_HUMANDisease (AMYL-TTR)  ---A/BT106N
74UniProtVAR_038985I127MTTHY_HUMANDisease (AMYL-TTR)  ---A/BI107M
75UniProtVAR_007592I127VTTHY_HUMANDisease (AMYL-TTR)121918089A/BI107V
76UniProtVAR_007593A129TTTHY_HUMANDisease (DTTRH)267607159A/BA109T
77UniProtVAR_007594L131MTTHY_HUMANDisease (AMYL-TTR)121918073A/BL111M
78UniProtVAR_007595Y134CTTHY_HUMANDisease (AMYL-TTR)121918075A/BY114C
79UniProtVAR_007598Y134HTTHY_HUMANDisease (CTS1)121918088A/BY114H
80UniProtVAR_007596Y136STTHY_HUMANDisease (AMYL-TTR)730881167A/BY116S
81UniProtVAR_007597Y136VTTHY_HUMANUnclassified  ---A/BY116V
82UniProtVAR_007599T139MTTHY_HUMANPolymorphism28933981A/BT119M
83UniProtVAR_038986A140STTHY_HUMANDisease (AMYL-TTR)876658108A/BA120S
84UniProtVAR_038987V142ATTHY_HUMANDisease (AMYL-TTR)  ---A/BV122A
85UniProtVAR_007600V142ITTHY_HUMANDisease (AMYL-TTR)28933980A/BV122I
86UniProtVAR_038988N144STTHY_HUMANDisease (AMYL-TTR)144965179AN124S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRANSTHYRETIN_1PS00768 Transthyretin signature 1.TTHY_HUMAN35-50
 
  2A:15-30
B:15-30
2TRANSTHYRETIN_2PS00769 Transthyretin signature 2.TTHY_HUMAN125-137
 
  2A:105-117
B:105-117
Biological Unit 1 (2, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRANSTHYRETIN_1PS00768 Transthyretin signature 1.TTHY_HUMAN35-50
 
  4A:15-30
B:15-30
2TRANSTHYRETIN_2PS00769 Transthyretin signature 2.TTHY_HUMAN125-137
 
  4A:105-117
B:105-117

(-) Exons   (3, 6)

Asymmetric Unit (3, 6)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002370141aENSE00001836564chr18:29171689-29171934246TTHY_HUMAN1-23230--
1.2ENST000002370142ENSE00000796938chr18:29172859-29172989131TTHY_HUMAN24-67442A:10-47
B:10-47
38
38
1.3aENST000002370143aENSE00000796939chr18:29175083-29175218136TTHY_HUMAN67-112462A:47-92
B:47-92
46
46
1.8aENST000002370148aENSE00001827041chr18:29178531-29178974444TTHY_HUMAN113-147352A:93-124
B:93-123 (gaps)
32
31

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:115
 aligned with TTHY_HUMAN | P02766 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:115
                                    39        49        59        69        79        89        99       109       119       129       139     
           TTHY_HUMAN    30 CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTN 144
               SCOP domains d3d2ta_ A: Transthyretin (synonym: prealbumin)                                                                      SCOP domains
               CATH domains 3d2tA00 A:10-124  [code=2.60.40.180, no name defined]                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee....ee....eeeeeee.....eeeeeeee.....ee...........eeeeeeehhhhhhhhh.....eeeeeeeeee......eeeeeeeee..eeeeeeeee. Sec.struct. author
             SAPs(SNPs) (1) R-PI----E-I--NS---M-A--CTNP-A--LD-SD-A-AI-PEGP--HKAG--L---LHNA-VH--YF-----N----KNS--A--G---SR-C-NM-T-M--C-S--MS-A-S SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------G-----------G--I----V---G--S-E-IR---KQ--R--K----------------------S----Q-------S------H--V------H-V-----I-- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------------------L--L-----------T-R------------------------------------T---------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) --------------------M--V-------------V----------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE -----TRANSTHYRETIN_1 --------------------------------------------------------------------------TRANSTHYRETIN------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: A:10-47 UniProt: 24-67 ---------------------------------------------Exon 1.8a  PDB: A:93-124         Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.3a  PDB: A:47-92 UniProt: 67-112       -------------------------------- Transcript 1 (2)
                 3d2t A  10 CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTN 124
                                    19        29        39        49        59        69        79        89        99       109       119     

Chain B from PDB  Type:PROTEIN  Length:109
 aligned with TTHY_HUMAN | P02766 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:114
                                    39        49        59        69        79        89        99       109       119       129       139    
           TTHY_HUMAN    30 CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVT 143
               SCOP domains d3d2tb_ B: Transthyretin (synonym: prealbumin)                                                                     SCOP domains
               CATH domains 3d2tB00 B:10-123  [code=2.60.40.180, no name defined]                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeee....ee....eeeeeee.....eeeeeeee.....ee...........eeeeeeehhhhhhhh......eeeeeeeeee.-----.eeeeeeee..eeeeeeee. Sec.struct. author
             SAPs(SNPs) (1) R-PI----E-I--NS---M-A--CTNP-A--LD-SD-A-AI-PEGP--HKAG--L---LHNA-VH--YF-----N----KNS--A--G------C-NM-T-M--C-S--MS-A- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------G-----------G--I----V---G--S-E-IR---KQ--R--K----------------------S----Q-------S------H--V------H-V-----I- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------------------L--L-----------T-R------------------------------------T--------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) --------------------M--V-------------V---------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE -----TRANSTHYRETIN_1 --------------------------------------------------------------------------TRANSTHYRETIN------ PROSITE
           Transcript 1 (1) Exon 1.2  PDB: B:10-47 UniProt: 24-67 ---------------------------------------------Exon 1.8a  PDB: B:93-123 (gaps) Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.3a  PDB: B:47-92 UniProt: 67-112       ------------------------------- Transcript 1 (2)
                 3d2t B  10 CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTAN-----RYTIAALLSPYSYSTTAVVT 123
                                    19        29        39        49        59        69        79        89        |-    |  109       119    
                                                                                                                   98   104                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3D2T)

(-) Gene Ontology  (15, 15)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (TTHY_HUMAN | P02766)
molecular function
    GO:0005179    hormone activity    The action characteristic of a hormone, any substance formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells in the same organism, upon which it has a specific regulatory action. The term was originally applied to agents with a stimulatory physiological action in vertebrate animals (as opposed to a chalone, which has a depressant action). Usage is now extended to regulatory compounds in lower animals and plants, and to synthetic substances having comparable effects; all bind receptors and trigger some biological process.
    GO:0042562    hormone binding    Interacting selectively and non-covalently with any hormone, naturally occurring substances secreted by specialized cells that affect the metabolism or behavior of other cells possessing functional receptors for the hormone.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
biological process
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0030198    extracellular matrix organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
    GO:0001523    retinoid metabolic process    The chemical reactions and pathways involving retinoids, any member of a class of isoprenoids that contain or are derived from four prenyl groups linked head-to-tail. Retinoids include retinol and retinal and structurally similar natural derivatives or synthetic compounds, but need not have vitamin A activity.
    GO:0042572    retinol metabolic process    The chemical reactions and pathways involving retinol, one of the three compounds that makes up vitamin A.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1FL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3d2t)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3d2t
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TTHY_HUMAN | P02766
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  105210
    Disease InformationOMIM
  115430
    Disease InformationOMIM
  145680
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TTHY_HUMAN | P02766
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TTHY_HUMAN | P027661bm7 1bmz 1bz8 1bzd 1bze 1dvq 1dvs 1dvt 1dvu 1dvx 1dvy 1dvz 1e3f 1e4h 1e5a 1eta 1etb 1f41 1f64 1f86 1fh2 1fhn 1g1o 1gko 1ict 1iii 1iik 1ijn 1qab 1qwh 1rlb 1sok 1soq 1tha 1thc 1tlm 1tsh 1tt6 1tta 1ttb 1ttc 1ttr 1tyr 1tz8 1u21 1x7s 1x7t 1y1d 1z7j 1zcr 1zd6 2b14 2b15 2b16 2b77 2b9a 2f7i 2f8i 2fbr 2flm 2g3x 2g3z 2g4e 2g4g 2g5u 2g9k 2gab 2h4e 2m5n 2nbo 2nbp 2noy 2pab 2qel 2qgb 2qgc 2qgd 2qge 2rox 2roy 2trh 2try 2wqa 3a4d 3a4e 3a4f 3b56 3bsz 3bt0 3cbr 3cfm 3cfn 3cfq 3cft 3cn0 3cn1 3cn2 3cn3 3cn4 3cxf 3d7p 3dgd 3did 3djr 3djs 3djt 3djz 3dk0 3dk2 3do4 3esn 3eso 3esp 3fc8 3fcb 3glz 3gps 3grb 3grg 3gs0 3gs4 3gs7 3hj0 3i9a 3i9i 3i9p 3imr 3ims 3imt 3imu 3imv 3imw 3ipb 3ipe 3kgs 3kgt 3kgu 3m1o 3nee 3neo 3nes 3nex 3ng5 3ozk 3ozl 3p3r 3p3s 3p3t 3p3u 3ssg 3tct 3tfb 3u2i 3u2j 3w3b 4abq 4abu 4abv 4abw 4ac2 4ac4 4act 4ank 4d7b 4der 4des 4det 4deu 4dew 4fi6 4fi7 4fi8 4hiq 4his 4hjs 4hjt 4hju 4i85 4i87 4i89 4iiz 4ik6 4ik7 4iki 4ikj 4ikk 4ikl 4ky2 4l1s 4l1t 4mas 4mrb 4mrc 4n85 4n86 4n87 4pm1 4pme 4pmf 4pvl 4pvm 4pvn 4pwe 4pwf 4pwg 4pwh 4pwi 4pwj 4pwk 4qrf 4qxv 4qya 4tkw 4tl4 4tl5 4tlk 4tls 4tlt 4tlu 4tm9 4tne 4tnf 4tng 4tq8 4tqh 4tqi 4tqp 4wnj 4wns 4wo0 4y9b 4y9c 4y9e 4y9f 4y9g 4ydm 4ydn 5a6i 5aks 5akt 5akv 5al0 5al8 5ayt 5boj 5clx 5cly 5clz 5cm1 5cn3 5cnh 5cr1 5dej 5dwp 5e23 5e4a 5e4o 5en3 5ezp 5fo2 5fw6 5fw7 5fw8 5h0v 5h0w 5h0x 5h0y 5h0z 5hjg 5ihh 5jid 5jim 5jiq 5k1j 5k1n 5l4f 5l4i 5l4j 5l4m 5lll 5llv 5ttr 5tzl

(-) Related Entries Specified in the PDB File

1bmz 2b77 2b9a 2f7i