Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  PARTIAL STRUCTURE OF 16S RNA OF THE SMALL RIBOSOMAL SUBUNIT FROM THERMUS THERMOPHILUS
 
Authors :  A. Tocilj, F. Schlunzen, D. Janell, M. Gluhmann, H. Hansen, J. Harms, A. Bashan, H. Bartels, I. Agmon, F. Franceschi, A. Yonath
Date :  19 Jan 00  (Deposition) - 02 Feb 00  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  4.50
Chains :  Asym./Biol. Unit :  A#,E,G
( #:   chains that contain no standard or modified protein/DNA/RNA residue)
 
Keywords :  Ribosomes, 30S, Thermus Thermophilus, 16S Rna (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Tocilj, F. Schlunzen, D. Janell, M. Gluhmann, H. A. Hansen, J. Harms, A. Bashan, H. Bartels, I. Agmon, F. Franceschi, A. Yonath
The Small Ribosomal Subunit From Thermus Thermophilus At 4. 5 A Resolution: Pattern Fittings And The Identification Of A Functional Site.
Proc. Natl. Acad. Sci. Usa V. 96 14252 1999
PubMed-ID: 10588692  |  Reference-DOI: 10.1073/PNAS.96.25.14252
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 16S RIBOSOMAL RNA
    Chains: A
    Organism Scientific: THERMUS THERMOPHILUS
    Organism Taxid: 274
 
Molecule 2 - RIBOSOMAL PROTEIN S5
    Chains: E
    Fragment: RESIDUES 4-148
    Organism Scientific: GEOBACILLUS STEAROTHERMOPHILUS
    Organism Taxid: 1422
    Synonym: BS5
 
Molecule 3 - RIBOSOMAL PROTEIN S7
    Chains: G
    Fragment: RESIDUES 12-146
    Organism Scientific: THERMUS THERMOPHILUS
    Organism Taxid: 274

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : AEG
( #:   chains that contain no standard or modified protein/DNA/RNA residue)
 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1WO21Ligand/IonOCTADECATUNGSTENYL DIPHOSPHATE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG E:49 , GLU E:75BINDING SITE FOR RESIDUE WO2 E 1

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1DV4)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1DV4)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1DV4)

(-) PROSITE Motifs  (3, 3)

Asymmetric/Biological Unit (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1S5_DSRBDPS50881 S5 double stranded RNA-binding domain profile.RS5_GEOSE11-74  1E:31-94
2RIBOSOMAL_S7PS00052 Ribosomal protein S7 signature.RS7_THET820-46  1G:20-46
3RIBOSOMAL_S5PS00585 Ribosomal protein S5 signature.RS5_GEOSE28-60  1E:48-80

(-) Exons   (0, 0)

(no "Exon" information available for 1DV4)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain E from PDB  Type:PROTEIN  Length:145
 aligned with RS5_GEOSE | P02357 from UniProtKB/Swiss-Prot  Length:166

    Alignment length:145
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143     
            RS5_GEOSE     4 INPNKLELEERVVAVNRVAKVVKGGRRLRFSALVVVGDKNGHVGFGTGKAQEVPEAIRKAIEDAKKNLIEVPIVGTTIPHEVIGHFGAGEIILKPASEGTGVIAGGPARAVLELAGISDILSKSIGSNTPINMVRATFDGLKQLK 148
               SCOP domains d1dv4e_ E: 30S subunit                                                                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................................................................................................................................................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------S5_DSRBD  PDB: E:31-94 UniProt: 11-74                           -------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------RIBOSOMAL_S5  PDB: E:48-80       ---------------------------------------------------------------------------------------- PROSITE (3)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1dv4 E  24 INPNKLELEERVVAVNRVAKVVKGGRRLRFSALVVVGDKNGHVGFGTGKAQEVPEAIRKAIEDAKKNLIEVPIVGTTIPHEVIGHFGAGEIILKPASEGTGVIAGGPARAVLELAGISDILSKSIGSNTPINMVRATFDGLKQLK 168
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163     

Chain G from PDB  Type:PROTEIN  Length:135
 aligned with RS7_THET8 | P17291 from UniProtKB/Swiss-Prot  Length:156

    Alignment length:135
                                    21        31        41        51        61        71        81        91       101       111       121       131       141     
            RS7_THET8    12 LQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAE 146
               SCOP domains d1dv4g_ G: 30S subunit                                                                                                                  SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....................................................................................................................................... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------RIBOSOMAL_S7  PDB: G:20-46 ---------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1dv4 G  12 LQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAE 146
                                    21        31        41        51        61        71        81        91       101       111       121       131       141     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1DV4)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1DV4)

(-) Gene Ontology  (9, 16)

Asymmetric/Biological Unit(hide GO term definitions)
Chain E   (RS5_GEOSE | P02357)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0046677    response to antibiotic    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
    GO:0015935    small ribosomal subunit    The smaller of the two subunits of a ribosome.

Chain G   (RS7_THET8 | P17291)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0019843    rRNA binding    Interacting selectively and non-covalently with ribosomal RNA.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
    GO:0000049    tRNA binding    Interacting selectively and non-covalently with transfer RNA.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
    GO:0015935    small ribosomal subunit    The smaller of the two subunits of a ribosome.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    WO2  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1dv4)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1dv4
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RS5_GEOSE | P02357
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RS7_THET8 | P17291
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  RS5_GEOSE | P02357
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RS7_THET8 | P17291
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RS5_GEOSE | P02357: 1eg0 1pkp 1qd7
        RS7_THET8 | P17291: 1eg0 1fjg 1fka 1hnw 1hnx 1hnz 1hr0 1i94 1i95 1i96 1i97 1ibk 1ibl 1ibm 1j5e 1jgo 1jgp 1jgq 1l1u 1n32 1n33 1n34 1n36 1qd7 1rss 1twt 1vvj 1vy4 1vy5 1vy6 1vy7 1x18 1xmo 1xmq 1xnq 1xnr 2e5l 2f4v 2hhh 2uu9 2uua 2uub 2uuc 2uxb 2uxc 2uxd 2vqe 2vqf 2zm6 3oto 3t1h 3t1y 4aqy 4b3m 4b3r 4b3s 4b3t 4dr1 4dr2 4dr3 4dr4 4dr5 4dr6 4dr7 4duy 4duz 4dv0 4dv1 4dv2 4dv3 4dv4 4dv5 4dv6 4dv7 4gkj 4gkk 4ji0 4ji1 4ji2 4ji3 4ji4 4ji5 4ji6 4ji7 4ji8 4jv5 4jya 4k0k 4khp 4l47 4l71 4lel 4lf4 4lf5 4lf6 4lf7 4lf8 4lf9 4lfa 4lfb 4lfc 4lfz 4lnt 4lsk 4lt8 4nxm 4nxn 4ox9 4p6f 4p70 4tua 4tub 4tuc 4tud 4tue 4v42 4v49 4v4a 4v4i 4v4p 4v4r 4v4s 4v4t 4v4x 4v4y 4v4z 4v51 4v5a 4v5c 4v5d 4v5e 4v5f 4v5g 4v5j 4v5k 4v5l 4v5m 4v5n 4v5p 4v5q 4v5r 4v5s 4v68 4v6a 4v6f 4v6g 4v7j 4v7k 4v7l 4v7m 4v7w 4v7x 4v7y 4v7z 4v87 4v8a 4v8b 4v8c 4v8d 4v8e 4v8f 4v8g 4v8h 4v8i 4v8j 4v8n 4v8o 4v8q 4v8u 4v8x 4v90 4v95 4v97 4v9a 4v9b 4v9h 4v9i 4v9r 4v9s 4w2e 4w2f 4w2g 4w2h 4w2i 4w4g 4wpo 4wq1 4wqf 4wqr 4wqu 4wqy 4wr6 4wra 4wro 4wsd 4wsm 4wt1 4wt8 4wu1 4wzd 4wzo 4x62 4x64 4x65 4x66 4y4o 4y4p 4yhh 4ypb 4yy3 4yzv 4z3s 4z8c 4zer 4zsn 5a9z 5aa0 5br8 5czp 5d8b 5dfe 5dox 5doy 5e7k 5e81 5el4 5el5 5el6 5el7 5f8k 5fdu 5fdv 5hau 5hcp 5hcq 5hcr 5hd1 5ib7 5ib8 5ibb 5imq 5imr 5iwa 5j30 5j3c 5j4b 5j4c 5j8b 5lmn 5lmo 5lmp 5lmq 5lmr 5lms 5lmt 5lmu 5lmv

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1DV4)