|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 1SRJ) |
(no "Cis Peptide Bond" information available for 1SRJ) |
(no "SAP(SNP)/Variant" information available for 1SRJ) |
Asymmetric Unit (2, 3) Biological Unit 1 (2, 6) |
(no "Exon" information available for 1SRJ) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:118 aligned with SAV_STRAV | P22629 from UniProtKB/Swiss-Prot Length:183 Alignment length:121 46 56 66 76 86 96 106 116 126 136 146 156 SAV_STRAV 37 AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV 157 SCOP domains d1srja_ A: Streptavidin SCOP domains CATH domains 1srjA00 A:13-133 [code=2.40.128.30, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) AVIDIN_2 PDB: A:13-133 UniProt: 37-159 PROSITE (1) PROSITE (2) ---------------------------------------------------------------------------------------------------------AVIDIN_1 - PROSITE (2) Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 1srj A 13 AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPA---SGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV 133 22 32 42 52 62 | | 72 82 92 102 112 122 132 65 69 Chain B from PDB Type:PROTEIN Length:116 aligned with SAV_STRAV | P22629 from UniProtKB/Swiss-Prot Length:183 Alignment length:119 48 58 68 78 88 98 108 118 128 138 148 SAV_STRAV 39 AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV 157 SCOP domains d1srjb_ B: Streptavidin SCOP domains CATH domains 1srjB00 B:15-133 [code=2.40.128.30, no name define d] CATH domains Pfam domains (1) Avidin-1srjB01 B:15-132 - Pfam domains (1) Pfam domains (2) Avidin-1srjB02 B:15-132 - Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) AVIDIN_2 PDB: - UniProt: 37-159 PROSITE (1) PROSITE (2) -------------------------------------------------------------------------------------------------------AVIDIN_1 - PROSITE (2) Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript 1srj B 15 AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPA---SGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV 133 24 34 44 54 64| | 74 84 94 104 114 124 65 69
|
Asymmetric Unit
|
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B (SAV_STRAV | P22629)
|
|
|
|
|
|
|