|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 7)| Asymmetric Unit (3, 7) Biological Unit 1 (3, 14) |
Sites (7, 7)
Asymmetric Unit (7, 7)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2F01) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2F01) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2F01) |
PROSITE Motifs (1, 2)| Asymmetric Unit (1, 2) Biological Unit 1 (1, 4) |
Exons (0, 0)| (no "Exon" information available for 2F01) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:121 aligned with SAV_STRAV | P22629 from UniProtKB/Swiss-Prot Length:183 Alignment length:121 47 57 67 77 87 97 107 117 127 137 147 157 SAV_STRAV 38 EAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVK 158 SCOP domains d2f01a_ A: Streptavidin SCOP domains CATH domains 2f01A00 A:14-134 [code=2.40.128.30, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------AVIDIN_1 -- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 2f01 A 14 EAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVK 134 23 33 43 53 63 73 83 93 103 113 123 133 Chain B from PDB Type:PROTEIN Length:120 aligned with SAV_STRAV | P22629 from UniProtKB/Swiss-Prot Length:183 Alignment length:120 49 59 69 79 89 99 109 119 129 139 149 159 SAV_STRAV 40 GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP 159 SCOP domains d2f01b_ B: Streptavidin SCOP domains CATH domains 2f01B00 B:16-135 [code=2.40.128.30, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------AVIDIN_1 --- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript 2f01 B 16 GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP 135 25 35 45 55 65 75 85 95 105 115 125 135
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2F01) |
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A,B (SAV_STRAV | P22629)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|