|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1SRI) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1SRI) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1SRI) |
PROSITE Motifs (2, 4)
Asymmetric Unit (2, 4)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1SRI) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:118 aligned with SAV_STRAV | P22629 from UniProtKB/Swiss-Prot Length:183 Alignment length:121 46 56 66 76 86 96 106 116 126 136 146 156 SAV_STRAV 37 AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV 157 SCOP domains d1sria_ A: Streptavidin SCOP domains CATH domains 1sriA00 A:13-133 [code=2.40.128.30, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) AVIDIN_2 PDB: A:13-133 UniProt: 37-159 PROSITE (1) PROSITE (2) ---------------------------------------------------------------------------------------------------------AVIDIN_1 - PROSITE (2) Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 1sri A 13 AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPA---SGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV 133 22 32 42 52 62 | | 72 82 92 102 112 122 132 65 69 Chain B from PDB Type:PROTEIN Length:121 aligned with SAV_STRAV | P22629 from UniProtKB/Swiss-Prot Length:183 Alignment length:121 46 56 66 76 86 96 106 116 126 136 146 156 SAV_STRAV 37 AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV 157 SCOP domains d1srib_ B: Streptavidin SCOP domains CATH domains 1sriB00 B:13-133 [code=2.40.128.30, no name defined] CATH domains Pfam domains (1) --Avidin-1sriB01 B:15-132 - Pfam domains (1) Pfam domains (2) --Avidin-1sriB02 B:15-132 - Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) AVIDIN_2 PDB: B:13-133 UniProt: 37-159 PROSITE (1) PROSITE (2) ---------------------------------------------------------------------------------------------------------AVIDIN_1 - PROSITE (2) Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 1sri B 13 AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV 133 22 32 42 52 62 72 82 92 102 112 122 132
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A,B (SAV_STRAV | P22629)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|