|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3RDS) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3RDS) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3RDS) |
PROSITE Motifs (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3RDS) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:123 aligned with SAV_STRAV | P22629 from UniProtKB/Swiss-Prot Length:183 Alignment length:123 45 55 65 75 85 95 105 115 125 135 145 155 SAV_STRAV 36 AAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVK 158 SCOP domains d3rdsa_ A: automated matches SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---Avidin-3rdsA01 A:15-132 -- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -AVIDIN_2 PDB: A:13-134 UniProt: 37-159 PROSITE (1) PROSITE (2) ----------------------------------------------------------------------------------------------------------AVIDIN_1 -- PROSITE (2) Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript 3rds A 12 TAEAGITGTWYNQLGSTLIVTAGADGALTGTYESAVGNAEGSYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSASTWSGQYVGGAEARINTQVLTTSGTTEANAWKSTLVGHDTFTKVK 134 21 31 41 51 61 71 81 91 101 111 121 131
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3RDS) |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A (SAV_STRAV | P22629)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|