1SHY - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   THE CRYSTAL STRUCTURE OF HGF BETA-CHAIN IN COMPLEX WITH THE SEMA DOMAIN OF THE MET RECEPTOR.

Authors :   J. Stamos, C. Wiesmann

Date :   26 Feb 04 (Deposition) - 15 Jun 04 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.22

Chains :   Asym./Biol. Unit : A,B

Keywords :   Protease, Sema Domain, Psi Domain, Receptor Ectodomain Growth Factor, Growth Factor-Growth Factor Receptor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Stamos, R. A. Lazarus, X. Yao, D. Kirchhofer, C. Wiesmann
Crystal Structure Of The Hgf Beta-Chain In Complex With The Sema Domain Of The Met Receptor.
Embo J. V. 23 2325 2004
PubMed-ID: 15167892 | Reference-DOI: 10.1038/SJ.EMBOJ.7600243
(for further references see the PDB file header)

Molecule 1 - HEPATOCYTE GROWTH FACTOR
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	HGF BETA CHAIN
	Gene	:	HGF, HPTA
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	SCATTER FACTOR, SF, HEPATOPOEITIN A

Molecule 2 - HEPATOCYTE GROWTH FACTOR RECEPTOR
	Chains	:	B
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Cell Line	:	SF9
	Expression System Common	:	FALL ARMYWORM
	Expression System Taxid	:	7108
	Expression System Vector Type	:	BACULOVIRUS
	Fragment	:	MET RECEPTOR SEMA AND PSI DOMAIN
	Gene	:	MET
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	MET PROTO-ONCOGENE TYROSINE KINASE, C-MET, HGF RECEPTOR, HGF-SF RECEPTOR

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1SHY)

(no "Site" information available for 1SHY)

Asymmetric/Biological Unit

No.	Residues
1	A:519	-	A:535
2	A:612	-	A:679
3	A:642	-	A:658
4	A:669	-	A:697
5	B:95	-	B:101
6	B:98	-	B:160
7	B:133	-	B:141
8	B:172	-	B:175
9	B:298	-	B:363
10	B:385	-	B:397
11	B:520	-	B:538
12	B:526	-	B:561
13	B:529	-	B:545
14	B:541	-	B:551

(no "Cis Peptide Bond" information available for 1SHY)

Asymmetric/Biological Unit (9, 9)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_041738	R	143	Q	MET_HUMAN	Polymorphism	35469582	B	R	143	Q
2	UniProt	VAR_064855	H	150	Y	MET_HUMAN	Unclassified	---	B	H	150	Y
3	UniProt	VAR_041739	S	156	L	MET_HUMAN	Polymorphism	56311081	B	S	156	L
4	UniProt	VAR_041740	E	168	D	MET_HUMAN	Polymorphism	55985569	B	E	168	D
5	UniProt	VAR_032478	L	238	S	MET_HUMAN	Polymorphism	34349517	B	L	238	S
6	UniProt	VAR_032479	I	316	M	MET_HUMAN	Polymorphism	35225896	B	I	316	M
7	UniProt	VAR_006285	A	320	V	MET_HUMAN	Polymorphism	35776110	B	A	320	V
8	UniProt	VAR_032480	N	375	S	MET_HUMAN	Polymorphism	33917957	B	N	375	S
9	UniProt	VAR_064856	C	385	Y	MET_HUMAN	Polymorphism	752055485	B	C	385	Y

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRYPSIN_DOM	PS50240	Serine proteases, trypsin domain profile.	HGF_HUMAN	495-721	1	A:495-721

Asymmetric/Biological Unit (10, 10)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2a	ENST00000222390	2a	ENSE00001949645	chr7:81399514-81399200	315	HGF_HUMAN	1-30	30	0	-	-
1.3b	ENST00000222390	3b	ENSE00000698746	chr7:81392188-81392023	166	HGF_HUMAN	30-85	56	0	-	-
1.4b	ENST00000222390	4b	ENSE00001790262	chr7:81388120-81388008	113	HGF_HUMAN	85-123	39	0	-	-
1.5b	ENST00000222390	5b	ENSE00000698725	chr7:81386619-81386505	115	HGF_HUMAN	123-161	39	0	-	-
1.6a	ENST00000222390	6a	ENSE00000698723	chr7:81381578-81381436	143	HGF_HUMAN	161-209	49	0	-	-
1.7	ENST00000222390	7	ENSE00000698721	chr7:81374436-81374316	121	HGF_HUMAN	209-249	41	0	-	-
1.8	ENST00000222390	8	ENSE00000698671	chr7:81372787-81372669	119	HGF_HUMAN	249-289	41	0	-	-
1.10	ENST00000222390	10	ENSE00000698668	chr7:81359095-81358921	175	HGF_HUMAN	289-347	59	0	-	-
1.11	ENST00000222390	11	ENSE00000698665	chr7:81355333-81355206	128	HGF_HUMAN	347-390	44	0	-	-
1.12	ENST00000222390	12	ENSE00000698663	chr7:81350163-81350061	103	HGF_HUMAN	390-424	35	0	-	-
1.13	ENST00000222390	13	ENSE00000698662	chr7:81346681-81346548	134	HGF_HUMAN	424-469	46	0	-	-
1.14	ENST00000222390	14	ENSE00000698661	chr7:81340835-81340797	39	HGF_HUMAN	469-482	14	0	-	-
1.15	ENST00000222390	15	ENSE00000698660	chr7:81339559-81339463	97	HGF_HUMAN	482-514	33	1	A:495-514	20
1.16	ENST00000222390	16	ENSE00000698659	chr7:81336680-81336606	75	HGF_HUMAN	514-539	26	1	A:514-539	26
1.17	ENST00000222390	17	ENSE00000698658	chr7:81335743-81335603	141	HGF_HUMAN	539-586	48	1	A:539-586	48
1.18	ENST00000222390	18	ENSE00000698657	chr7:81335069-81334963	107	HGF_HUMAN	586-622	37	1	A:586-622	37
1.19	ENST00000222390	19	ENSE00000698655	chr7:81334851-81334706	146	HGF_HUMAN	622-670	49	1	A:622-670	49
1.20b	ENST00000222390	20b	ENSE00001870741	chr7:81332073-81328322	3752	HGF_HUMAN	671-728	58	1	A:671-722	52

2.1c	ENST00000397752	1c	ENSE00001865305	chr7:116312446-116312631	186	MET_HUMAN	-	0	0	-	-
2.3c	ENST00000397752	3c	ENSE00001238915	chr7:116339125-116340338	1214	MET_HUMAN	1-400	400	1	B:40-400 (gaps)	361
2.6	ENST00000397752	6	ENSE00000717722	chr7:116371722-116371913	192	MET_HUMAN	401-464	64	1	B:414-464	51
2.7	ENST00000397752	7	ENSE00000717724	chr7:116380004-116380138	135	MET_HUMAN	465-509	45	1	B:465-509	45
2.8	ENST00000397752	8	ENSE00000717726	chr7:116380906-116381079	174	MET_HUMAN	510-567	58	1	B:510-564	55
2.9b	ENST00000397752	9b	ENSE00000717728	chr7:116395409-116395569	161	MET_HUMAN	568-621	54	0	-	-
2.10	ENST00000397752	10	ENSE00000717730	chr7:116397491-116397593	103	MET_HUMAN	621-655	35	0	-	-
2.11b	ENST00000397752	11b	ENSE00000717732	chr7:116397692-116397828	137	MET_HUMAN	656-701	46	0	-	-
2.12a	ENST00000397752	12a	ENSE00000717735	chr7:116398513-116398674	162	MET_HUMAN	701-755	55	0	-	-
2.13b	ENST00000397752	13b	ENSE00001530016	chr7:116399445-116399544	100	MET_HUMAN	755-788	34	0	-	-
2.14	ENST00000397752	14	ENSE00000717791	chr7:116403104-116403322	219	MET_HUMAN	789-861	73	0	-	-
2.15a	ENST00000397752	15a	ENSE00000717803	chr7:116409699-116409845	147	MET_HUMAN	862-910	49	0	-	-
2.16	ENST00000397752	16	ENSE00000717811	chr7:116411552-116411708	157	MET_HUMAN	911-963	53	0	-	-
2.17	ENST00000397752	17	ENSE00000717833	chr7:116411903-116412043	141	MET_HUMAN	963-1010	48	0	-	-
2.18b	ENST00000397752	18b	ENSE00000717861	chr7:116414935-116415165	231	MET_HUMAN	1010-1087	78	0	-	-
2.19	ENST00000397752	19	ENSE00000717879	chr7:116417443-116417523	81	MET_HUMAN	1087-1114	28	0	-	-
2.20	ENST00000397752	20	ENSE00000717895	chr7:116418830-116419011	182	MET_HUMAN	1114-1174	61	0	-	-
2.21	ENST00000397752	21	ENSE00000717902	chr7:116422042-116422151	110	MET_HUMAN	1175-1211	37	0	-	-
2.22	ENST00000397752	22	ENSE00000717928	chr7:116423358-116423523	166	MET_HUMAN	1211-1266	56	0	-	-
2.23	ENST00000397752	23	ENSE00000717937	chr7:116435709-116435845	137	MET_HUMAN	1267-1312	46	0	-	-
2.24b	ENST00000397752	24b	ENSE00000881894	chr7:116435941-116438440	2500	MET_HUMAN	1312-1390	79	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:228
 aligned with HGF_HUMAN | P14210 from UniProtKB/Swiss-Prot  Length:728

    Alignment length:228
                                   504       514       524       534       544       554       564       574       584       594       604       614       624       634       644       654       664       674       684       694       704       714        
            HGF_HUMAN   495 VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILT 722
               SCOP domains d1shya_ A: Hepatocyte growth factor, HGF                                                                                                                                                                                             SCOP domains
               CATH domains 1shyA01    1shyA02 A:506-596,A:712-722 Trypsin-like serine proteases                                  1shyA01 A:495-505,A:597-711 Trypsin-like serine proteases                                                          1shyA02     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....ee.......eeeeee..eeeeeeeeee..eeeee.hhh...hhh.eeeee..............eee.eeeeee......eeeeee..........................eeeeee.............eeeeeeeehhhhhhhhh.........eeeee...............eeeee....eeeeee.............eeeee...hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE TRYPSIN_DOM  PDB: A:495-721 UniProt: 495-721                                                                                                                                                                                       - PROSITE
           Transcript 1 (1) Exon 1.15           ------------------------Exon 1.17  PDB: A:539-586 UniProt: 539-586      -----------------------------------Exon 1.19  PDB: A:622-670 UniProt: 622-670       Exon 1.20b  PDB: A:671-722 UniProt: 671-728          Transcript 1 (1)
           Transcript 1 (2) -------------------Exon 1.16  PDB: A:514-539 ----------------------------------------------Exon 1.18  PDB: A:586-622            ---------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1shy A 495 VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGSTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILT 722
                                   504       514       524       534       544       554       564       574       584       594       604       614       624       634       644       654       664       674       684       694       704       714

Chain B from PDB  Type:PROTEIN  Length:499
 aligned with MET_HUMAN | P08581 from UniProtKB/Swiss-Prot  Length:1390

    Alignment length:525
                                    49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559     
            MET_HUMAN    40 KYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICLPA 564
               SCOP domains d1shyb1 B:40-515 Hepatocyte growth factor receptor                                                                                                                                                                                                                                                                                                                                                                                                                                          d1shyb2 B:516-564                                 SCOP domains
               CATH domains 1shyB01 B:40-515 YVTN repeat-like/Quinoprotein amine dehydrogenase                                                                                                                                                                                                                                                                                                                                                                                                                          1shyB02 B:516-564                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee....eeeeeee..eeeeee..eeeeee.....eeeeee...eee...................eee...eeeeeee.....eeeeee......eeeee............eee.....................eeeeeeee..eeeeeeee..............eeeeee......ee..hhh.ee....hhhhhh..eeeeeeee..eeeeeee...........eeeeeee.........eeeeeeee..---------........eeeee..hhhhhhhh.......eeeeeeeee......eeeeeeeeeeehhhhhhhhhh.----...................-------------....ee....eeee...........eeeeeeeee..eeeeeeee...eeeeee............ee.....eeeeeeeeee...eeeeeeee..eeeeee.hhhhhh...hhhhhhhhhhhhh.eee..eeehhhhh............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------Q------Y-----L-----------D---------------------------------------------------------------------S-----------------------------------------------------------------------------M---V------------------------------------------------------S---------Y----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 2 Exon 2.3c  PDB: B:40-400 (gaps) UniProt: 1-400 [INCOMPLETE]                                                                                                                                                                                                                                                                                                              Exon 2.6  PDB: B:414-464 UniProt: 401-464 [INCOMPLETE]          Exon 2.7  PDB: B:465-509 UniProt: 465-509    Exon 2.8  PDB: B:510-564 UniProt: 510-567 [INCOMPLETE]  Transcript 2
                 1shy B  40 KYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECILT---------KEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKI----NVRCLQHFYGPNHEHCFNR-------------DEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICLPA 564
                                    49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299 |       - |     319       329       339       349       359       369       | -  |    389       399|        -    |  419       429       439       449       459       469       479       489       499       509       519       529       539       549       559     
                                                                                                                                                                                                                                                                                               301       311                                                               377  382               400           414

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "Pfam Domain" information available for 1SHY)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (HGF_HUMAN | P14210)

molecular function
	GO:0042056	chemoattractant activity	Providing the environmental signal that initiates the directed movement of a motile cell or organism towards a higher concentration of that signal.
	GO:0008083	growth factor activity	The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0000187	activation of MAPK activity	The initiation of the activity of the inactive enzyme MAP kinase (MAPK).
	GO:0031100	animal organ regeneration	The regrowth of a lost or destroyed animal organ.
	GO:0060326	cell chemotaxis	The directed movement of a motile cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).
	GO:0000902	cell morphogenesis	The developmental process in which the size or shape of a cell is generated and organized.
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0035729	cellular response to hepatocyte growth factor stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hepatocyte growth factor stimulus.
	GO:0001837	epithelial to mesenchymal transition	A transition where an epithelial cell loses apical/basolateral polarity, severs intercellular adhesive junctions, degrades basement membrane components and becomes a migratory mesenchymal cell.
	GO:0048012	hepatocyte growth factor receptor signaling pathway	The series of molecular signals generated as a consequence of the hepatocyte growth factor receptor binding to one of its physiological ligands.
	GO:0030212	hyaluronan metabolic process	The chemical reactions and pathways involving hyaluronan, the naturally occurring anionic form of hyaluronic acid, any member of a group of glycosaminoglycans, the repeat units of which consist of beta-1,4 linked D-glucuronyl-beta-(1,3)-N-acetyl-D-glucosamine.
	GO:0001889	liver development	The process whose specific outcome is the progression of the liver over time, from its formation to the mature structure. The liver is an exocrine gland which secretes bile and functions in metabolism of protein and carbohydrate and fat, synthesizes substances involved in the clotting of the blood, synthesizes vitamin A, detoxifies poisonous substances, stores glycogen, and breaks down worn-out erythrocytes.
	GO:0051450	myoblast proliferation	The multiplication or reproduction of myoblasts, resulting in the expansion of a myoblast cell population. A myoblast is a mononucleate cell type that, by fusion with other myoblasts, gives rise to the myotubes that eventually develop into skeletal muscle fibers.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0010507	negative regulation of autophagy	Any process that stops, prevents, or reduces the frequency, rate or extent of autophagy. Autophagy is the process in which cells digest parts of their own cytoplasm.
	GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of a cysteine-type endopeptidase activity involved in the apoptotic process.
	GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway via death domain receptors.
	GO:1901299	negative regulation of hydrogen peroxide-mediated programmed cell death	Any process that stops, prevents or reduces the frequency, rate or extent of hydrogen peroxide-mediated programmed cell death.
	GO:0050728	negative regulation of inflammatory response	Any process that stops, prevents, or reduces the frequency, rate or extent of the inflammatory response.
	GO:0032715	negative regulation of interleukin-6 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-6 production.
	GO:0033137	negative regulation of peptidyl-serine phosphorylation	Any process that stops, prevents, or reduces the frequency, rate or extent of the phosphorylation of peptidyl-serine.
	GO:0090201	negative regulation of release of cytochrome c from mitochondria	Any process that decreases the rate, frequency or extent of release of cytochrome c from mitochondria, the process in which cytochrome c is enabled to move from the mitochondrial intermembrane space into the cytosol, which is an early step in apoptosis and leads to caspase activation.
	GO:0002576	platelet degranulation	The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
	GO:0050918	positive chemotaxis	The directed movement of a motile cell or organism towards a higher concentration of a chemical.
	GO:2000573	positive regulation of DNA biosynthetic process	Any process that activates or increases the frequency, rate or extent of DNA biosynthetic process.
	GO:0045766	positive regulation of angiogenesis	Any process that activates or increases angiogenesis.
	GO:0030335	positive regulation of cell migration	Any process that activates or increases the frequency, rate or extent of cell migration.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0032733	positive regulation of interleukin-10 production	Any process that activates or increases the frequency, rate, or extent of interleukin-10 production.
	GO:0031643	positive regulation of myelination	Any process that activates or increases the frequency, rate or extent of the formation of a myelin sheath around nerve axons.
	GO:0070572	positive regulation of neuron projection regeneration	Any process that activates or increases the frequency, rate or extent of neuron projection regeneration, the regrowth of neuronal processes such as axons or dendrites following their loss or damage.
	GO:0045669	positive regulation of osteoblast differentiation	Any process that activates or increases the frequency, rate or extent of osteoblast differentiation.
	GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
	GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0060665	regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling	Any process that modulates the rate, frequency, or extent of branching involved in salivary gland morphogenesis as a result of signals being generated by the mesenchyme and received and interpreted by the salivary gland epithelium.
	GO:1900744	regulation of p38MAPK cascade	Any process that modulates the frequency, rate or extent of p38MAPK cascade.
	GO:1902947	regulation of tau-protein kinase activity	Any process that modulates the frequency, rate or extent of tau-protein kinase activity.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0031093	platelet alpha granule lumen	The volume enclosed by the membrane of the platelet alpha granule.

Chain B (MET_HUMAN | P08581)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0005008	hepatocyte growth factor-activated receptor activity	Combining with hepatocyte growth factor and transmitting the signal across the plasma membrane to initiate a change in cell activity.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0019903	protein phosphatase binding	Interacting selectively and non-covalently with any protein phosphatase.
	GO:0004713	protein tyrosine kinase activity	Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0004714	transmembrane receptor protein tyrosine kinase activity	Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
biological process
	GO:0048754	branching morphogenesis of an epithelial tube	The process in which the anatomical structures of branches in an epithelial tube are generated and organized. A tube is a long hollow cylinder.
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0007166	cell surface receptor signaling pathway	A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0001886	endothelial cell morphogenesis	The change in form (cell shape and size) that occurs during the differentiation of an endothelial cell.
	GO:0048012	hepatocyte growth factor receptor signaling pathway	The series of molecular signals generated as a consequence of the hepatocyte growth factor receptor binding to one of its physiological ligands.
	GO:0010507	negative regulation of autophagy	Any process that stops, prevents, or reduces the frequency, rate or extent of autophagy. Autophagy is the process in which cells digest parts of their own cytoplasm.
	GO:1901299	negative regulation of hydrogen peroxide-mediated programmed cell death	Any process that stops, prevents or reduces the frequency, rate or extent of hydrogen peroxide-mediated programmed cell death.
	GO:0018108	peptidyl-tyrosine phosphorylation	The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0050918	positive chemotaxis	The directed movement of a motile cell or organism towards a higher concentration of a chemical.
	GO:2001028	positive regulation of endothelial cell chemotaxis	Any process that activates or increases the frequency, rate or extent of endothelial cell chemotaxis.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:0071526	semaphorin-plexin signaling pathway	A series of molecular signals generated as a consequence of a semaphorin receptor (composed of a plexin and a neurophilin) binding to a semaphorin ligand.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:0009925	basal plasma membrane	The region of the plasma membrane located at the basal end of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1shy)

	Sites
(no "Sites" information available for 1shy)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1shy)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1shy
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	HGF_HUMAN \| P14210
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	MET_HUMAN \| P08581
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	HGF_HUMAN \| P14210
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	MET_HUMAN \| P08581
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1SHY)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (14, 14)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (9, 9)

PROSITE Motifs (1, 1)

Exons (10, 10)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 3)

CATH Domains (3, 4)

Pfam Domains (0, 0)

Gene Ontology (71, 80)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File