Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE STRUCTURE OF THE NK1 FRAGMENT OF HGF/SF COMPLEXED WITH CAPS
 
Authors :  A. G. Sigurdardottir, A. Winter, A. Sobkowicz, M. Fragai, D. Y. Chirgad D. B. Ascher, T. L. Blundell, E. Gherardi
Date :  23 Jul 15  (Deposition) - 12 Aug 15  (Release) - 26 Oct 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Hgf/Sf, Nk1 Fragment, Fragment Based Drug Discovery, Growth Factor, Cell Cycle, Hormone, New Chemical Entity (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. G. Sigurdardottir, A. Winter, A. Sobkowicz, M. Fragai, D. Y. Chirgadze, D. B. Ascher, T. L. Blundell, E. Gherardi
Exploring The Chemical Space Of The Lysine-Binding Pocket O The First Kringle Domain Of Hepatocyte Growth Factor/Scatte Factor (Hgf/Sf) Yields A New Class Of Inhibitors Of Hgf/Sf-Met Binding
Chem Sci V. 6 6147 2015
PubMed: search  |  Reference-DOI: 10.1039/C5SC02155C

(-) Compounds

Molecule 1 - HEPATOCYTE GROWTH FACTOR
    Chains: A, B
    Engineered: YES
    Expression System: KOMAGATAELLA PASTORIS CBS 7435
    Expression System Taxid: 981350
    Fragment: UNP RESIDUES 28-210
    Gene: HGF, HPTA
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: HEPATOPOIETIN-A,SCATTER FACTOR,SF

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1CXS2Ligand/Ion3-CYCLOHEXYL-1-PROPYLSULFONIC ACID

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:183 , GLU A:184 , PHE A:190 , ARG A:197 , TYR A:198 , VAL A:200 , HOH A:409 , HOH A:426binding site for residue CXS A 301
2AC2SOFTWAREPHE B:162 , GLU B:183 , GLU B:184 , TRP B:188 , PHE B:190 , ARG B:197 , TYR B:198 , VAL B:200 , HOH B:427 , HOH B:457binding site for residue CXS B 301

(-) SS Bonds  (10, 10)

Asymmetric/Biological Unit
No.Residues
1A:70 -A:96
2A:74 -A:84
3A:128 -A:206
4A:149 -A:189
5A:177 -A:201
6B:70 -B:96
7B:74 -B:84
8B:128 -B:206
9B:149 -B:189
10B:177 -B:201

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Ile A:156 -Pro A:157
2Ile B:156 -Pro B:157

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5CT2)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5CT2)

(-) Exons   (0, 0)

(no "Exon" information available for 5CT2)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:173
                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhh.eeeeeeeeeee.......eeee..hhhhhhhhhhhh........eeeee....eeeee........eeeeeeeeeeeeee.hhh.....................................hhhhh....................eee.......eee.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ct2 A  38 TIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE 210
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207   


Chain B from PDB  Type:PROTEIN  Length:173
                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhh.eeeeeeeeeee.......eeee..hhhhhhhhhhhh........eeeee....eeeee........eeeeeeeeeeeeee.hhh.....................................hhhhhh...................eee.......eee......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ct2 B  37 NTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEV 209
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5CT2)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5CT2)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5CT2)

(-) Gene Ontology  (47, 47)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CXS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ile A:156 - Pro A:157   [ RasMol ]  
    Ile B:156 - Pro B:157   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ct2
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HGF_HUMAN | P14210
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HGF_HUMAN | P14210
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HGF_HUMAN | P14210: 1bht 1gmn 1gmo 1gp9 1nk1 1shy 1si5 2ced 2cee 2ceg 2hgf 2qj2 3hms 3hmt 3hn4 3mkp 3sp8 4d3c 4k3j 4o3t 4o3u 5coe 5cp9 5cs1 5cs3 5cs5 5cs9 5csq 5ct1 5ct3

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5CT2)