1B2O - JenaLib

Title :   CLOSTRIDIUM PASTEURIANUM RUBREDOXIN G10VG43A MUTANT

Authors :   M. J. Maher, J. M. Guss, M. C. J. Wilce, A. G. Wedd

Date :   30 Nov 98 (Deposition) - 27 May 99 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Electron Transport, Metalloprotein, Iron Sulfur, Electron Transfer (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. J. Maher, Z. Xiao, M. C. Wilce, J. M. Guss, A. G. Wedd
Rubredoxin From Clostridium Pasteurianum. Structures Of G10A, G43A And G10Vg43A Mutant Proteins. Mutation Of Conserved Glycine 10 To Valine Causes The 9-10 Peptide Link To Invert.
Acta Crystallogr. , Sect. D V. 55 962 1999
PubMed-ID: 10216292 | Reference-DOI: 10.1107/S0907444999001900
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 4)

Asymmetric Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RUBREDOXIN_LIKE	PS50903	Rubredoxin-like domain profile.	RUBR_CLOPA	1-52	2	A:1-52 B:1-52
2	RUBREDOXIN	PS00202	Rubredoxin signature.	RUBR_CLOPA	33-43	2	A:33-42 B:33-42

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RUBREDOXIN_LIKE	PS50903	Rubredoxin-like domain profile.	RUBR_CLOPA	1-52	1	A:1-52 -
2	RUBREDOXIN	PS00202	Rubredoxin signature.	RUBR_CLOPA	33-43	1	A:33-42 -

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RUBREDOXIN_LIKE	PS50903	Rubredoxin-like domain profile.	RUBR_CLOPA	1-52	1	- B:1-52
2	RUBREDOXIN	PS00202	Rubredoxin signature.	RUBR_CLOPA	33-43	1	- B:33-42

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:54
 aligned with RUBR_CLOPA | P00268 from UniProtKB/Swiss-Prot  Length:54

    Alignment length:54
                                    10        20        30        40        50    
            RUBR_CLOPA    1 MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE 54
               SCOP domains d1b2oa_ A: Rubredoxin                                  SCOP domains
               CATH domains 1b2oA00 A:1-54  [code=2.20.28.10, no name defined]     CATH domains
               Pfam domains ------------------------------------------------------ Pfam domains
         Sec.struct. author ...eee.............hhh.......hhh.............hhheee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) RUBREDOXIN_LIKE  PDB: A:1-52 UniProt: 1-52          -- PROSITE (1)
                PROSITE (2) --------------------------------RUBREDOXIN ----------- PROSITE (2)
                 Transcript ------------------------------------------------------ Transcript
                  1b2o A  1 MKKYTCTVCVYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE 54
                                    10        20        30        40        50

Chain B from PDB  Type:PROTEIN  Length:54
 aligned with RUBR_CLOPA | P00268 from UniProtKB/Swiss-Prot  Length:54

    Alignment length:54
                                    10        20        30        40        50    
            RUBR_CLOPA    1 MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE 54
               SCOP domains d1b2ob_ B: Rubredoxin                                  SCOP domains
               CATH domains 1b2oB00 B:1-54  [code=2.20.28.10, no name defined]     CATH domains
               Pfam domains ------------------------------------------------------ Pfam domains
         Sec.struct. author ...eee.............hhh.......hhh.............hhheee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) RUBREDOXIN_LIKE  PDB: B:1-52 UniProt: 1-52          -- PROSITE (1)
                PROSITE (2) --------------------------------RUBREDOXIN ----------- PROSITE (2)
                 Transcript ------------------------------------------------------ Transcript
                  1b2o B  1 MKKYTCTVCVYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE 54
                                    10        20        30        40        50

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (4, 4)

Asymmetric Unit(hide GO term definitions)

Chain A,B (RUBR_CLOPA | P00268)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		FEA	[ RasMol ]	+environment [ RasMol ]
		FEB	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1b2o)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1b2o
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RUBR_CLOPA \| P00268
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	RUBR_CLOPA \| P00268
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description