|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1T9Q) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1T9Q) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1T9Q) |
PROSITE Motifs (2, 2)
Asymmetric/Biological Unit (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1T9Q) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:53 aligned with RUBR_CLOPA | P00268 from UniProtKB/Swiss-Prot Length:54 Alignment length:53 10 20 30 40 50 RUBR_CLOPA 1 MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVE 53 SCOP domains d1t9qa_ A: Rubredoxin SCOP domains CATH domains 1t9qA00 A:1-53 [code=2.20.28.10, no name defined] CATH domains Pfam domains --Rubredoxin-1t9qA01 A:3-49 ---- Pfam domains SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs) PROSITE (1) RUBREDOXIN_LIKE PDB: A:1-52 UniProt: 1-52 - PROSITE (1) PROSITE (2) --------------------------------RUBREDOXIN ---------- PROSITE (2) Transcript ----------------------------------------------------- Transcript 1t9q A 1 MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGLGKDQFEEVE 53 10 20 30 40 50
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (RUBR_CLOPA | P00268)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|