Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)

(-) Description

Title :  DBR1 IN COMPLEX WITH 7-MER BRANCHED RNA
 
Authors :  N. E. Clark, A. B. Taylor, P. J. Hart
Date :  25 May 16  (Deposition) - 07 Dec 16  (Release) - 07 Dec 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.17
Chains :  Asym. Unit :  A,B,C,D,E,V,W,X,Y,Z,v,w,x,y,z
Biol. Unit 1:  A,V,v  (1x)
Biol. Unit 2:  B,W,w  (1x)
Biol. Unit 3:  C,X,x  (1x)
Biol. Unit 4:  D,Y,y  (1x)
Biol. Unit 5:  E,Z,z  (1x)
Keywords :  Metalloenzyme, Complex, Branched Rna, Hydrolase-Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  N. E. Clark, A. Katolik, K. Roberts, A. B. Taylor, S. P. Holloway, J. P. Schuermann, E. J. Montemayor, S. W. Stevens, P. F. Fitzpatrick, M. J. Damha, P. J. Hart
The Rna Lariat Debranching Enzyme Dbr1: Metal Dependence An Branched Rna Co-Crystal Structures
Proc. Natl. Acad. Sci. Usa 2016
PubMed: search  |  Reference-DOI: 10.1073/PNAS.1612729114

(-) Compounds

Molecule 1 - RNA LARIAT DEBRANCHING ENZYME, PUTATIVE
    Chains: A, B, C, D, E
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: EHI_062730
    Organism Scientific: ENTAMOEBA HISTOLYTICA
    Organism Taxid: 5759
 
Molecule 2 - BRANCH 1 OF BRANCHED RNA 5'-UAA(-2'GU)CA-3'
    Chains: V, W, X, Y, Z
    Engineered: YES
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
    Other Details: THIS IS A 2' BRANCHED RNA 5'-UAA(-2'GU)CA-3'
    Synthetic: YES
 
Molecule 3 - BRNCH 2 OF BRANCHED RNA 5'-UAA(-2'GU)CA-3'
    Chains: v, w, x, y, z
    Engineered: YES
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
    Other Details: THIS IS A 2' BRANCHED RNA 5'-UAA(-2'GU)CA-3'
    Synthetic: YES

 Structural Features

(-) Chains, Units

  123456789101112131415
Asymmetric Unit : ABCDEVWXYZvwxyz
Biological Unit 1 (1x): A    V    v    
Biological Unit 2 (1x):  B    W    w   
Biological Unit 3 (1x):   C    X    x  
Biological Unit 4 (1x):    D    Y    y 
Biological Unit 5 (1x):     E    Z    z

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 40)

Asymmetric Unit (4, 40)
No.NameCountTypeFull Name
1FE25Ligand/IonFE (II) ION
2OH5Ligand/IonHYDROXIDE ION
3SO425Ligand/IonSULFATE ION
4ZN5Ligand/IonZINC ION
Biological Unit 1 (2, 6)
No.NameCountTypeFull Name
1FE21Ligand/IonFE (II) ION
2OH-1Ligand/IonHYDROXIDE ION
3SO45Ligand/IonSULFATE ION
4ZN-1Ligand/IonZINC ION
Biological Unit 2 (2, 5)
No.NameCountTypeFull Name
1FE21Ligand/IonFE (II) ION
2OH-1Ligand/IonHYDROXIDE ION
3SO44Ligand/IonSULFATE ION
4ZN-1Ligand/IonZINC ION
Biological Unit 3 (2, 8)
No.NameCountTypeFull Name
1FE21Ligand/IonFE (II) ION
2OH-1Ligand/IonHYDROXIDE ION
3SO47Ligand/IonSULFATE ION
4ZN-1Ligand/IonZINC ION
Biological Unit 4 (2, 6)
No.NameCountTypeFull Name
1FE21Ligand/IonFE (II) ION
2OH-1Ligand/IonHYDROXIDE ION
3SO45Ligand/IonSULFATE ION
4ZN-1Ligand/IonZINC ION
Biological Unit 5 (2, 5)
No.NameCountTypeFull Name
1FE21Ligand/IonFE (II) ION
2OH-1Ligand/IonHYDROXIDE ION
3SO44Ligand/IonSULFATE ION
4ZN-1Ligand/IonZINC ION

(-) Sites  (45, 45)

Asymmetric Unit (45, 45)
No.NameEvidenceResiduesDescription
01AC1SOFTWARECYS A:14 , HIS A:16 , ASP A:45 , HIS A:232 , FE2 A:402 , OH A:408 , G v:510binding site for residue ZN A 401
02AC2SOFTWAREASP A:45 , ASN A:90 , HIS A:180 , HIS A:230 , ZN A:401 , OH A:408 , G v:510binding site for residue FE2 A 402
03AC3SOFTWAREARG A:50 , ASN A:95 , HIS A:99 , PRO A:146binding site for residue SO4 A 403
04AC4SOFTWARELYS A:18 , TYR A:64 , LYS A:249 , TYR A:252 , A V:501binding site for residue SO4 A 404
05AC5SOFTWARELYS A:320 , TYR A:321 , TYR B:74binding site for residue SO4 A 405
06AC6SOFTWARETYR A:74 , HOH A:547 , LYS D:320 , TYR D:321binding site for residue SO4 A 406
07AC7SOFTWARELYS A:289 , THR A:338binding site for residue SO4 A 407
08AC8SOFTWARECYS A:14 , ASP A:45 , HIS A:180 , HIS A:230 , HIS A:232 , ZN A:401 , FE2 A:402 , G v:510binding site for residue OH A 408
09AC9SOFTWAREASP B:45 , ASN B:90 , HIS B:180 , HIS B:230 , ZN B:402 , OH B:407 , G w:510binding site for residue FE2 B 401
10AD1SOFTWARECYS B:14 , HIS B:16 , ASP B:45 , HIS B:232 , FE2 B:401 , OH B:407 , G w:510binding site for residue ZN B 402
11AD2SOFTWAREARG B:50 , ASN B:95 , HIS B:99 , PRO B:146 , HOH B:513 , HOH B:559binding site for residue SO4 B 403
12AD3SOFTWARELYS B:18 , LYS B:249 , A W:501binding site for residue SO4 B 404
13AD4SOFTWAREGLN B:184 , GLY B:185 , LYS B:215 , HOH B:510 , HOH B:557 , THR C:307 , LYS C:308binding site for residue SO4 B 405
14AD5SOFTWARETHR B:307 , LYS B:308 , LYS C:215 , HOH C:546binding site for residue SO4 B 406
15AD6SOFTWARECYS B:14 , ASP B:45 , HIS B:180 , HIS B:230 , HIS B:232 , FE2 B:401 , ZN B:402 , G w:510binding site for residue OH B 407
16AD7SOFTWARECYS C:14 , HIS C:16 , ASP C:45 , HIS C:232 , FE2 C:402 , OH C:410 , G x:510binding site for residue ZN C 401
17AD8SOFTWAREASP C:45 , ASN C:90 , HIS C:180 , HIS C:230 , ZN C:401 , OH C:410 , G x:510binding site for residue FE2 C 402
18AD9SOFTWAREARG C:50 , ASN C:95 , HIS C:99 , PRO C:146 , HOH C:505 , HOH C:516 , HOH C:574binding site for residue SO4 C 403
19AE1SOFTWARELYS C:320 , TYR C:321 , HOH C:503 , HOH C:515 , TYR D:51 , TYR D:74 , THR D:332binding site for residue SO4 C 404
20AE2SOFTWAREGLN C:199 , CYS C:233 , GLU C:234 , ASN C:254 , HOH C:598binding site for residue SO4 C 405
21AE3SOFTWARELYS C:18 , LYS C:249 , A X:501binding site for residue SO4 C 406
22AE4SOFTWARELYS C:189 , GLU C:238 , GLU C:239 , GLY C:240binding site for residue SO4 C 407
23AE5SOFTWAREARG C:20 , ARG C:24binding site for residue SO4 C 408
24AE6SOFTWARETYR C:74 , HOH C:577 , LYS E:320 , TYR E:321binding site for residue SO4 C 409
25AE7SOFTWARECYS C:14 , ASP C:45 , HIS C:180 , HIS C:230 , HIS C:232 , ZN C:401 , FE2 C:402 , G x:510binding site for residue OH C 410
26AE8SOFTWAREASP D:45 , ASN D:90 , HIS D:180 , HIS D:230 , ZN D:402 , OH D:408 , G y:510binding site for residue FE2 D 401
27AE9SOFTWARECYS D:14 , HIS D:16 , ASP D:45 , HIS D:232 , FE2 D:401 , OH D:408 , G y:510binding site for residue ZN D 402
28AF1SOFTWAREARG D:50 , ASN D:95 , HIS D:99 , PRO D:146 , HOH D:517 , HOH D:533 , HOH D:550binding site for residue SO4 D 403
29AF2SOFTWARESER D:172 , GLN D:173binding site for residue SO4 D 404
30AF3SOFTWAREGLN D:163 , SER D:298 , ILE D:299 , SER D:300 , HOH D:590binding site for residue SO4 D 405
31AF4SOFTWAREGLY D:68 , HIS D:71 , LEU D:72 , HOH D:599binding site for residue SO4 D 406
32AF5SOFTWARELYS D:18 , TYR D:64 , LYS D:249 , TYR D:252 , A Y:501binding site for residue SO4 D 407
33AF6SOFTWARECYS D:14 , ASP D:45 , HIS D:180 , HIS D:230 , HIS D:232 , FE2 D:401 , ZN D:402 , G y:510binding site for residue OH D 408
34AF7SOFTWAREASP E:45 , ASN E:90 , HIS E:180 , HIS E:230 , ZN E:402 , OH E:407 , G z:510binding site for residue FE2 E 401
35AF8SOFTWARECYS E:14 , HIS E:16 , ASP E:45 , HIS E:232 , FE2 E:401 , OH E:407 , G z:510binding site for residue ZN E 402
36AF9SOFTWAREARG E:50 , ASN E:95 , HIS E:99 , PRO E:146 , HOH E:509 , HOH E:529 , HOH E:545binding site for residue SO4 E 403
37AG1SOFTWARELYS E:18 , TYR E:64 , LYS E:249 , TYR E:252 , A Z:501binding site for residue SO4 E 404
38AG2SOFTWAREGLN E:163 , SER E:298 , ILE E:299 , SER E:300binding site for residue SO4 E 405
39AG3SOFTWARELYS B:320 , TYR B:321 , TYR E:51 , TYR E:74 , HOH E:570binding site for residue SO4 E 406
40AG4SOFTWARECYS E:14 , ASP E:45 , HIS E:180 , HIS E:230 , HIS E:232 , FE2 E:401 , ZN E:402 , G z:510binding site for residue OH E 407
41AG5SOFTWAREHIS A:16 , ASP A:45 , GLN A:47 , VAL A:60 , PRO A:61 , TYR A:64 , ASN A:90 , GLY A:201 , PHE A:202 , ASP A:205 , LEU A:209 , HIS A:230 , MET A:231 , HIS A:232 , LYS A:249 , ZN A:401 , FE2 A:402 , SO4 A:404 , OH A:408 , HOH A:529 , HOH A:534 , U v:511 , HOH v:601 , A V:500 , C V:502binding site for Di-nucleotide G G 510 and A V 501
42AG6SOFTWAREHIS B:16 , ASP B:45 , GLN B:47 , PRO B:61 , LYS B:63 , TYR B:64 , ASN B:90 , GLY B:201 , ASP B:205 , LEU B:209 , HIS B:230 , MET B:231 , HIS B:232 , LYS B:249 , FE2 B:401 , ZN B:402 , SO4 B:404 , OH B:407 , HOH B:549 , U w:511 , A W:500 , C W:502binding site for Di-nucleotide G H 510 and A W 501
43AG7SOFTWAREHIS C:16 , ASP C:45 , GLN C:47 , VAL C:60 , PRO C:61 , TYR C:64 , ASN C:90 , GLY C:201 , PHE C:202 , ASP C:205 , LEU C:209 , HIS C:230 , MET C:231 , HIS C:232 , LYS C:249 , ZN C:401 , FE2 C:402 , SO4 C:406 , OH C:410 , HOH C:532 , HOH C:592 , U x:511 , HOH x:601 , A X:500 , C X:502binding site for Di-nucleotide G I 510 and A X 501
44AG8SOFTWAREHIS D:16 , ASP D:45 , GLN D:47 , VAL D:60 , PRO D:61 , TYR D:64 , ASN D:90 , GLY D:201 , PHE D:202 , ASP D:205 , LEU D:209 , HIS D:230 , MET D:231 , HIS D:232 , LYS D:249 , FE2 D:401 , ZN D:402 , SO4 D:407 , OH D:408 , HOH D:523 , U y:511 , A Y:500 , C Y:502binding site for Di-nucleotide G J 510 and A Y 501
45AG9SOFTWAREHIS E:16 , ASP E:45 , GLN E:47 , VAL E:60 , PRO E:61 , TYR E:64 , ASN E:90 , GLY E:201 , PHE E:202 , ASP E:205 , LEU E:209 , HIS E:230 , MET E:231 , HIS E:232 , LYS E:249 , FE2 E:401 , ZN E:402 , SO4 E:404 , OH E:407 , U z:511 , A Z:500 , C Z:502 , HOH Z:602binding site for Di-nucleotide G K 510 and A Z 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5K77)

(-) Cis Peptide Bonds  (10, 10)

Asymmetric Unit
No.Residues
1Tyr A:144 -Pro A:145
2Phe A:292 -Pro A:293
3Tyr B:144 -Pro B:145
4Phe B:292 -Pro B:293
5Tyr C:144 -Pro C:145
6Phe C:292 -Pro C:293
7Tyr D:144 -Pro D:145
8Phe D:292 -Pro D:293
9Tyr E:144 -Pro E:145
10Phe E:292 -Pro E:293

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5K77)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5K77)

(-) Exons   (0, 0)

(no "Exon" information available for 5K77)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:349
                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeee...hhhhhhhhhhhhhhhhh..eeeeeeee......hhhhhhhh..hhhhh...hhhhhhh........eee......hhhhhhhh...eeee..eee...eeeeee..eeeeee....hhhhh...ee...hhhhh........hhhhhhh.........eeee.....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh..eeee......eeeee..eeeee.........eeeeeee.......eehhhhhhhhhhhhhhhh...ee.....hhhhhhh..hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k77 A   5 QIQHIAIVGCVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEADLVYLKVPPKYKQMGDFHLYYEGKEKAPYLTLFIGGNAESSNVLLHLYNGGFVCFNMYYLGVCSCININGLRIVGVSGIYKSFDEKKPYTYPPSPNDVVSLFHTRNYVIQMLSNLSQSSQIDISLSHDWPQGIVMKGNYKQLYRFQPGFKKDGASLGSPINKVILNTLKPKYWISGHMHCEYHAEEGPTHFIALGKIGYKNAISYLDLPLKQKTDLEYDKDWVCNLIMTWPAFSNKAQFPDLSYSISELLSKRTKELDKKIIELWEKYIGLKIIYDSDTFDIQFTSRRFYIEKIYNELNI 353
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344         


Chain B from PDB  Type:PROTEIN  Length:349
                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.....hhhhhhhhhhhhhhhhh..eeeeee........hhhhhhhh..hhhhh...hhhhhhh........eee......hhhhhhhh...eeee..eee...eeeeee..eeeeee....hhhhh...ee...hhhhhhh......hhhhhhhhhhh.....eeee.....hhhhhhhhhhhhh.hhhhh.hhhhh.hhhhhhhhhhhh..eeee......eeeee..eeeee.....hhh.eeeeeee.......eehhhhhhhhhhhhhhhh...ee.....hhhhhhh..hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k77 B   5 QIQHIAIVGCVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEADLVYLKVPPKYKQMGDFHLYYEGKEKAPYLTLFIGGNAESSNVLLHLYNGGFVCFNMYYLGVCSCININGLRIVGVSGIYKSFDEKKPYTYPPSPNDVVSLFHTRNYVIQMLSNLSQSSQIDISLSHDWPQGIVMKGNYKQLYRFQPGFKKDGASLGSPINKVILNTLKPKYWISGHMHCEYHAEEGPTHFIALGKIGYKNAISYLDLPLKQKTDLEYDKDWVCNLIMTWPAFSNKAQFPDLSYSISELLSKRTKELDKKIIELWEKYIGLKIIYDSDTFDIQFTSRRFYIEKIYNELNI 353
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344         


Chain C from PDB  Type:PROTEIN  Length:349
                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.....hhhhhhhhhhhhhhhhh..eeeeee........hhhhhhhh..hhhhh...hhhhhhh........eee......hhhhhhhh...eeee..eee...eeeeee..eeeeee....hhhhh...ee...hhhhh........hhhhhhh.........eeee.....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh..eeee......eeeee..eeeee.........eeeeeee.......eehhhhhhhhhhhhhhhh...ee.....hhhhhhh..hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k77 C   5 QIQHIAIVGCVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEADLVYLKVPPKYKQMGDFHLYYEGKEKAPYLTLFIGGNAESSNVLLHLYNGGFVCFNMYYLGVCSCININGLRIVGVSGIYKSFDEKKPYTYPPSPNDVVSLFHTRNYVIQMLSNLSQSSQIDISLSHDWPQGIVMKGNYKQLYRFQPGFKKDGASLGSPINKVILNTLKPKYWISGHMHCEYHAEEGPTHFIALGKIGYKNAISYLDLPLKQKTDLEYDKDWVCNLIMTWPAFSNKAQFPDLSYSISELLSKRTKELDKKIIELWEKYIGLKIIYDSDTFDIQFTSRRFYIEKIYNELNI 353
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344         


Chain D from PDB  Type:PROTEIN  Length:349
                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.....hhhhhhhhhhhhhhhhh..eeeeee........hhhhhhhh..hhhhh...hhhhhhh........eee......hhhhhhhh...eeee..eee...eeeeee..eeeeee....hhhhh...ee...hhhhh........hhhhhhh.........eeee.....hhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhhhhhhh..eeee......eeeee..eeeee.....hhh.eeeeeee.......eehhhhhhhhhhhhhhhh...ee.....hhhhhhh..hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k77 D   5 QIQHIAIVGCVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEADLVYLKVPPKYKQMGDFHLYYEGKEKAPYLTLFIGGNAESSNVLLHLYNGGFVCFNMYYLGVCSCININGLRIVGVSGIYKSFDEKKPYTYPPSPNDVVSLFHTRNYVIQMLSNLSQSSQIDISLSHDWPQGIVMKGNYKQLYRFQPGFKKDGASLGSPINKVILNTLKPKYWISGHMHCEYHAEEGPTHFIALGKIGYKNAISYLDLPLKQKTDLEYDKDWVCNLIMTWPAFSNKAQFPDLSYSISELLSKRTKELDKKIIELWEKYIGLKIIYDSDTFDIQFTSRRFYIEKIYNELNI 353
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344         


Chain E from PDB  Type:PROTEIN  Length:349
                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.....hhhhhhhhhhhhhhhhh....eeee........hhhhhhhh..hhhhh...hhhhhhh........eee......hhhhhhhh...eeee..eee...eeeeee..eeeeee....hhhhh...ee...hhhhh........hhhhhhh.........eeee.....hhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhhhhhhh..eeee......eeeee..eeeee.........eeeeeee.......eehhhhhhhhhhhhhhhh...ee.....hhhhhhh..hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k77 E   5 QIQHIAIVGCVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEADLVYLKVPPKYKQMGDFHLYYEGKEKAPYLTLFIGGNAESSNVLLHLYNGGFVCFNMYYLGVCSCININGLRIVGVSGIYKSFDEKKPYTYPPSPNDVVSLFHTRNYVIQMLSNLSQSSQIDISLSHDWPQGIVMKGNYKQLYRFQPGFKKDGASLGSPINKVILNTLKPKYWISGHMHCEYHAEEGPTHFIALGKIGYKNAISYLDLPLKQKTDLEYDKDWVCNLIMTWPAFSNKAQFPDLSYSISELLSKRTKELDKKIIELWEKYIGLKIIYDSDTFDIQFTSRRFYIEKIYNELNI 353
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344         


Chain V from PDB  Type:DNA/RNA  Length:4
                                    
                 5k77 V 500 AACA 503


Chain W from PDB  Type:DNA/RNA  Length:4
                                    
                 5k77 W 500 AACA 503


Chain X from PDB  Type:DNA/RNA  Length:4
                                    
                 5k77 X 500 AACA 503


Chain Y from PDB  Type:DNA/RNA  Length:4
                                    
                 5k77 Y 500 AACA 503


Chain Z from PDB  Type:DNA/RNA  Length:4
                                    
                 5k77 Z 500 AACA 503


Chain v from PDB  Type:DNA/RNA  Length:2
                                  
                 5k77 v 510 GU 511


Chain w from PDB  Type:DNA/RNA  Length:2
                                  
                 5k77 w 510 GU 511


Chain x from PDB  Type:DNA/RNA  Length:2
                                  
                 5k77 x 510 GU 511


Chain y from PDB  Type:DNA/RNA  Length:2
                                  
                 5k77 y 510 GU 511


Chain z from PDB  Type:DNA/RNA  Length:2
                                  
                 5k77 z 510 GU 511
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5K77)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5K77)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5K77)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FE2  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
    AG5  [ RasMol ]  +environment [ RasMol ]
    AG6  [ RasMol ]  +environment [ RasMol ]
    AG7  [ RasMol ]  +environment [ RasMol ]
    AG8  [ RasMol ]  +environment [ RasMol ]
    AG9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Phe A:292 - Pro A:293   [ RasMol ]  
    Phe B:292 - Pro B:293   [ RasMol ]  
    Phe C:292 - Pro C:293   [ RasMol ]  
    Phe D:292 - Pro D:293   [ RasMol ]  
    Phe E:292 - Pro E:293   [ RasMol ]  
    Tyr A:144 - Pro A:145   [ RasMol ]  
    Tyr B:144 - Pro B:145   [ RasMol ]  
    Tyr C:144 - Pro C:145   [ RasMol ]  
    Tyr D:144 - Pro D:145   [ RasMol ]  
    Tyr E:144 - Pro E:145   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format | Biol. Unit 5 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5k77
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  C4M1P9_ENTHI | C4M1P9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  C4M1P9_ENTHI | C4M1P9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        C4M1P9_ENTHI | C4M1P9: 4pef 4peg 4peh 4pei 5k71 5k73 5k78

(-) Related Entries Specified in the PDB File

5k71 5k73 5k78