Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
(-)Biological Unit 7
(-)Biological Unit 8
(-)Biological Unit 9
(-)Biological Unit 10
(-)Biological Unit 11
(-)Biological Unit 12
(-)Biological Unit 13
(-)Biological Unit 14
(-)Biological Unit 15
(-)Biological Unit 16
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)
Image Biological Unit 7
Biological Unit 7  (Jmol Viewer)
Image Biological Unit 8
Biological Unit 8  (Jmol Viewer)
Image Biological Unit 9
Biological Unit 9  (Jmol Viewer)
Image Biological Unit 10
Biological Unit 10  (Jmol Viewer)
Image Biological Unit 11
Biological Unit 11  (Jmol Viewer)
Image Biological Unit 12
Biological Unit 12  (Jmol Viewer)
Image Biological Unit 13
Biological Unit 13  (Jmol Viewer)
Image Biological Unit 14
Biological Unit 14  (Jmol Viewer)
Image Biological Unit 15
Biological Unit 15  (Jmol Viewer)
Image Biological Unit 16
Biological Unit 16  (Jmol Viewer)

(-) Description

Title :  AZURIN T30R1, CRYSTAL FORM II
 
Authors :  G. Hagelueken
Date :  08 Feb 16  (Deposition) - 13 Apr 16  (Release) - 20 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.95
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  E  (1x)
Biol. Unit 6:  F  (1x)
Biol. Unit 7:  G  (1x)
Biol. Unit 8:  H  (1x)
Biol. Unit 9:  I  (1x)
Biol. Unit 10:  J  (1x)
Biol. Unit 11:  K  (1x)
Biol. Unit 12:  L  (1x)
Biol. Unit 13:  M  (1x)
Biol. Unit 14:  N  (1x)
Biol. Unit 15:  O  (1x)
Biol. Unit 16:  P  (1x)
Keywords :  Blue Copper Protein, Spin Label, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Abdullin, G. Hagelueken, O. Schiemann
Determination Of Nitroxide Spin Label Conformations Via Peldor And X-Ray Crystallography.
Phys Chem Chem Phys V. 18 10428 2016
PubMed-ID: 27029516  |  Reference-DOI: 10.1039/C6CP01307D

(-) Compounds

Molecule 1 - AZURIN
    ChainsA, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneAZU, PA4922
    Organism ScientificPSEUDOMONAS AERUGINOSA (STRAIN ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
    Organism Taxid287

 Structural Features

(-) Chains, Units

  12345678910111213141516
Asymmetric Unit ABCDEFGHIJKLMNOP
Biological Unit 1 (1x)A               
Biological Unit 2 (1x) B              
Biological Unit 3 (1x)  C             
Biological Unit 4 (1x)   D            
Biological Unit 5 (1x)    E           
Biological Unit 6 (1x)     F          
Biological Unit 7 (1x)      G         
Biological Unit 8 (1x)       H        
Biological Unit 9 (1x)        I       
Biological Unit 10 (1x)         J      
Biological Unit 11 (1x)          K     
Biological Unit 12 (1x)           L    
Biological Unit 13 (1x)            M   
Biological Unit 14 (1x)             N  
Biological Unit 15 (1x)              O 
Biological Unit 16 (1x)               P

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 33)

Asymmetric Unit (3, 33)
No.NameCountTypeFull Name
1CU16Ligand/IonCOPPER (II) ION
2GOL1Ligand/IonGLYCEROL
3R1A16Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2GOL1Ligand/IonGLYCEROL
3R1A1Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2GOL-1Ligand/IonGLYCEROL
3R1A1Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2GOL-1Ligand/IonGLYCEROL
3R1A1Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE
Biological Unit 4 (1, 1)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2GOL-1Ligand/IonGLYCEROL
3R1A1Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE
Biological Unit 5 (1, 1)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2GOL-1Ligand/IonGLYCEROL
3R1A1Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE
Biological Unit 6 (1, 1)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2GOL-1Ligand/IonGLYCEROL
3R1A1Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE
Biological Unit 7 (1, 1)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2GOL-1Ligand/IonGLYCEROL
3R1A1Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE
Biological Unit 8 (1, 1)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2GOL-1Ligand/IonGLYCEROL
3R1A1Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE
Biological Unit 9 (1, 1)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2GOL-1Ligand/IonGLYCEROL
3R1A1Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE
Biological Unit 10 (1, 1)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2GOL-1Ligand/IonGLYCEROL
3R1A1Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE
Biological Unit 11 (1, 1)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2GOL-1Ligand/IonGLYCEROL
3R1A1Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE
Biological Unit 12 (1, 1)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2GOL-1Ligand/IonGLYCEROL
3R1A1Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE
Biological Unit 13 (1, 1)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2GOL-1Ligand/IonGLYCEROL
3R1A1Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE
Biological Unit 14 (1, 1)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2GOL-1Ligand/IonGLYCEROL
3R1A1Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE
Biological Unit 15 (1, 1)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2GOL-1Ligand/IonGLYCEROL
3R1A1Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE
Biological Unit 16 (1, 1)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2GOL-1Ligand/IonGLYCEROL
3R1A1Mod. Amino Acid3-{[(2,2,5,5-TETRAMETHYL-1-OXO-2,5-DIHYDRO-1H-PYRROLIUM-3-YL)METHYL]DISULFANYL}-D-ALANINE

(-) Sites  (47, 47)

Asymmetric Unit (47, 47)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLY A:45 , HIS A:46 , CYS A:112 , HIS A:117 , MET A:121binding site for residue CU A 201
02AC2SOFTWAREASP A:69binding site for residue GOL A 202
03AC3SOFTWAREGLY B:45 , HIS B:46 , CYS B:112 , HIS B:117 , MET B:121binding site for residue CU B 201
04AC4SOFTWAREGLY C:45 , HIS C:46 , CYS C:112 , HIS C:117 , MET C:121binding site for residue CU C 201
05AC5SOFTWAREGLY D:45 , HIS D:46 , CYS D:112 , HIS D:117 , MET D:121binding site for residue CU D 201
06AC6SOFTWAREGLY E:45 , HIS E:46 , CYS E:112 , PHE E:114 , HIS E:117 , MET E:121binding site for residue CU E 201
07AC7SOFTWAREGLY F:45 , HIS F:46 , CYS F:112 , HIS F:117 , MET F:121binding site for residue CU F 201
08AC8SOFTWAREGLY G:45 , HIS G:46 , CYS G:112 , HIS G:117 , MET G:121binding site for residue CU G 201
09AC9SOFTWAREGLY H:45 , HIS H:46 , CYS H:112 , HIS H:117 , MET H:121binding site for residue CU H 201
10AD1SOFTWAREGLY I:45 , HIS I:46 , CYS I:112 , HIS I:117 , MET I:121binding site for residue CU I 201
11AD2SOFTWAREGLY J:45 , HIS J:46 , CYS J:112 , HIS J:117 , MET J:121binding site for residue CU J 201
12AD3SOFTWAREGLY K:45 , HIS K:46 , CYS K:112 , PHE K:114 , HIS K:117 , MET K:121binding site for residue CU K 201
13AD4SOFTWAREGLY L:45 , HIS L:46 , CYS L:112 , HIS L:117 , MET L:121binding site for residue CU L 201
14AD5SOFTWAREGLY M:45 , HIS M:46 , CYS M:112 , HIS M:117 , MET M:121binding site for residue CU M 201
15AD6SOFTWAREGLY N:45 , HIS N:46 , CYS N:112 , HIS N:117 , MET N:121binding site for residue CU N 201
16AD7SOFTWAREGLY O:45 , HIS O:46 , CYS O:112 , HIS O:117 , MET O:121binding site for residue CU O 201
17AD8SOFTWAREGLY P:45 , HIS P:46 , CYS P:112 , HIS P:117 , MET P:121binding site for residue CU P 201
18AD9SOFTWARECYS B:3 , SER B:4 , VAL B:5 , ASP B:6 , VAL B:22 , GLN B:28 , VAL B:31 , ASN B:32 , VAL B:95 , THR B:96 , PHE B:97 , GLN P:28 , R1A P:30 , THR P:96binding site for Di-peptide PHE B 29 and R1A B 30
19AE1SOFTWARECYS B:3 , SER B:4 , VAL B:5 , ASP B:6 , PHE B:29 , ASN B:32 , TRP B:48 , SER B:94 , VAL B:95 , THR B:96 , GLN P:28 , R1A P:30 , THR P:96binding site for Di-peptide R1A B 30 and VAL B 31
20AE2SOFTWARECYS A:3 , GLN A:28 , CYS C:3 , SER C:4 , VAL C:5 , ASP C:6 , GLN C:28 , VAL C:31 , ASN C:32 , VAL C:95 , THR C:96 , PHE C:97binding site for Di-peptide PHE C 29 and R1A C 30
21AE3SOFTWARECYS A:3 , GLN A:28 , CYS C:3 , SER C:4 , VAL C:5 , ASP C:6 , ILE C:7 , PHE C:29 , ASN C:32 , TRP C:48 , SER C:94 , VAL C:95 , THR C:96binding site for Di-peptide R1A C 30 and VAL C 31
22AE4SOFTWARECYS D:3 , SER D:4 , VAL D:5 , VAL D:22 , GLN D:28 , VAL D:31 , ASN D:32 , SER D:94 , VAL D:95 , THR D:96 , PHE D:97 , CYS M:3 , GLN M:28 , PHE M:29binding site for Di-peptide PHE D 29 and R1A D 30
23AE5SOFTWARECYS D:3 , SER D:4 , VAL D:5 , ILE D:7 , PHE D:29 , ASN D:32 , TRP D:48 , SER D:94 , VAL D:95 , THR D:96 , CYS M:3 , GLN M:28 , PHE M:29binding site for Di-peptide R1A D 30 and VAL D 31
24AE6SOFTWARECYS E:3 , SER E:4 , VAL E:5 , ASP E:6 , GLN E:28 , VAL E:31 , ASN E:32 , SER E:94 , VAL E:95 , THR E:96 , PHE E:97binding site for Di-peptide PHE E 29 and R1A E 30
25AE7SOFTWARECYS E:3 , SER E:4 , VAL E:5 , ASP E:6 , ILE E:7 , GLN E:28 , PHE E:29 , ASN E:32 , TRP E:48 , SER E:94 , VAL E:95 , THR E:96binding site for Di-peptide R1A E 30 and VAL E 31
26AE8SOFTWARECYS F:3 , SER F:4 , VAL F:5 , ASP F:6 , GLN F:28 , VAL F:31 , ASN F:32 , SER F:94 , VAL F:95 , THR F:96 , PHE F:97 , GLN H:28 , PHE H:97 , ASP H:98binding site for Di-peptide PHE F 29 and R1A F 30
27AE9SOFTWARECYS F:3 , SER F:4 , VAL F:5 , ASP F:6 , ILE F:7 , PHE F:29 , ASN F:32 , TRP F:48 , SER F:94 , VAL F:95 , THR F:96 , GLN H:28 , PHE H:97 , ASP H:98binding site for Di-peptide R1A F 30 and VAL F 31
28AF1SOFTWARECYS G:3 , SER G:4 , VAL G:5 , VAL G:22 , GLN G:28 , VAL G:31 , VAL G:95 , THR G:96 , PHE G:97binding site for Di-peptide PHE G 29 and R1A G 30
29AF2SOFTWARECYS G:3 , SER G:4 , VAL G:5 , ILE G:7 , GLN G:28 , PHE G:29 , ASN G:32 , TRP G:48 , SER G:94 , VAL G:95 , THR G:96binding site for Di-peptide R1A G 30 and VAL G 31
30AF3SOFTWARECYS F:3 , GLN F:28 , THR F:96 , CYS H:3 , SER H:4 , VAL H:5 , ILE H:20 , GLN H:28 , VAL H:31 , ASN H:32 , VAL H:95 , THR H:96 , PHE H:97binding site for Di-peptide PHE H 29 and R1A H 30
31AF4SOFTWARECYS F:3 , GLN F:28 , THR F:96 , CYS H:3 , SER H:4 , VAL H:5 , ILE H:7 , GLN H:28 , PHE H:29 , ASN H:32 , LEU H:33 , TRP H:48 , SER H:94 , VAL H:95 , THR H:96binding site for Di-peptide R1A H 30 and VAL H 31
32AF5SOFTWARECYS I:3 , SER I:4 , VAL I:5 , ILE I:20 , GLN I:28 , VAL I:31 , VAL I:95 , THR I:96 , PHE I:97 , VAL I:99 , CYS L:3 , SER L:4 , GLN L:28 , THR L:96binding site for Di-peptide PHE I 29 and R1A I 30
33AF6SOFTWARECYS I:3 , SER I:4 , VAL I:5 , ILE I:7 , GLN I:28 , PHE I:29 , ASN I:32 , LEU I:33 , TRP I:48 , SER I:94 , VAL I:95 , THR I:96 , CYS L:3 , SER L:4 , GLN L:28 , THR L:96binding site for Di-peptide R1A I 30 and VAL I 31
34AF7SOFTWARECYS J:3 , SER J:4 , VAL J:5 , GLN J:28 , VAL J:31 , ASN J:32 , VAL J:95 , THR J:96 , PHE J:97binding site for Di-peptide PHE J 29 and R1A J 30
35AF8SOFTWARECYS J:3 , SER J:4 , VAL J:5 , ILE J:7 , GLN J:28 , PHE J:29 , ASN J:32 , TRP J:48 , SER J:94 , VAL J:95 , THR J:96binding site for Di-peptide R1A J 30 and VAL J 31
36AF9SOFTWARECYS K:3 , SER K:4 , VAL K:5 , ASP K:6 , GLN K:28 , VAL K:31 , ASN K:32 , SER K:94 , VAL K:95 , THR K:96 , PHE K:97binding site for Di-peptide PHE K 29 and R1A K 30
37AG1SOFTWARECYS K:3 , SER K:4 , VAL K:5 , ASP K:6 , GLN K:28 , PHE K:29 , ASN K:32 , TRP K:48 , SER K:94 , VAL K:95 , THR K:96binding site for Di-peptide R1A K 30 and VAL K 31
38AG2SOFTWAREGLN I:28 , PHE I:97 , HOH I:331 , CYS L:3 , SER L:4 , VAL L:5 , VAL L:22 , GLN L:28 , VAL L:31 , ASN L:32 , SER L:94 , VAL L:95 , THR L:96 , PHE L:97binding site for Di-peptide PHE L 29 and R1A L 30
39AG3SOFTWAREGLN I:28 , PHE I:97 , HOH I:331 , CYS L:3 , SER L:4 , VAL L:5 , PHE L:29 , ASN L:32 , TRP L:48 , SER L:94 , VAL L:95 , THR L:96binding site for Di-peptide R1A L 30 and VAL L 31
40AG4SOFTWAREGLN D:28 , R1A D:30 , THR D:96 , PHE D:97 , ASP D:98 , CYS M:3 , SER M:4 , VAL M:5 , ASP M:6 , GLN M:28 , VAL M:31 , ASN M:32 , SER M:94 , VAL M:95 , THR M:96 , PHE M:97binding site for Di-peptide PHE M 29 and R1A M 30
41AG5SOFTWAREGLN D:28 , THR D:96 , PHE D:97 , ASP D:98 , CYS M:3 , SER M:4 , VAL M:5 , ASP M:6 , ILE M:7 , PHE M:29 , ASN M:32 , SER M:94 , VAL M:95 , THR M:96binding site for Di-peptide R1A M 30 and VAL M 31
42AG6SOFTWARECYS N:3 , SER N:4 , VAL N:5 , GLN N:28 , VAL N:31 , ASN N:32 , SER N:94 , VAL N:95 , THR N:96 , PHE N:97 , CYS O:3 , GLN O:28 , R1A O:30 , THR O:96binding site for Di-peptide PHE N 29 and R1A N 30
43AG7SOFTWARECYS N:3 , SER N:4 , VAL N:5 , ILE N:7 , GLN N:28 , PHE N:29 , ASN N:32 , TRP N:48 , SER N:94 , VAL N:95 , THR N:96 , CYS O:3 , GLN O:28 , R1A O:30 , THR O:96binding site for Di-peptide R1A N 30 and VAL N 31
44AG8SOFTWAREGLN N:28 , R1A N:30 , THR N:96 , PHE N:97 , ASP N:98 , CYS O:3 , SER O:4 , VAL O:5 , ASP O:6 , GLN O:28 , VAL O:31 , ASN O:32 , VAL O:95 , THR O:96 , PHE O:97binding site for Di-peptide PHE O 29 and R1A O 30
45AG9SOFTWAREGLN N:28 , R1A N:30 , THR N:96 , PHE N:97 , ASP N:98 , CYS O:3 , SER O:4 , VAL O:5 , ASP O:6 , ILE O:7 , PHE O:29 , ASN O:32 , TRP O:48 , SER O:94 , VAL O:95 , THR O:96binding site for Di-peptide R1A O 30 and VAL O 31
46AH1SOFTWAREGLN B:28 , R1A B:30 , CYS P:3 , SER P:4 , VAL P:5 , GLN P:28 , VAL P:31 , ASN P:32 , VAL P:95 , THR P:96 , PHE P:97binding site for Di-peptide PHE P 29 and R1A P 30
47AH2SOFTWAREGLN B:28 , R1A B:30 , CYS P:3 , SER P:4 , VAL P:5 , ILE P:7 , PHE P:29 , ASN P:32 , TRP P:48 , SER P:94 , VAL P:95 , THR P:96binding site for Di-peptide R1A P 30 and VAL P 31

(-) SS Bonds  (16, 16)

Asymmetric Unit
No.Residues
1A:3 -A:26
2B:3 -B:26
3C:3 -C:26
4D:3 -D:26
5E:3 -E:26
6F:3 -F:26
7G:3 -G:26
8H:3 -H:26
9I:3 -I:26
10J:3 -J:26
11K:3 -K:26
12L:3 -L:26
13M:3 -M:26
14N:3 -N:26
15O:3 -O:26
16P:3 -P:26

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5I28)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5I28)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5I28)

(-) Exons   (0, 0)

(no "Exon" information available for 5I28)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..........eeeee....eeeeeee.....hhhhhh...eeeehhhhhhhhhhhhhhhhhhh..........ee........eeeeeee.hhh.....eeee....hhhhh.eeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i28 A   1 AECSVDIQGNDQMQFNTNAITVDKSCKQFxVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
                                                        30-R1A                                                                                              

Chain B from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..........eeeee....eeeeeee.....hhhhhh...eeee..hhhhhhhhhhhhhhhhh..........ee........eeeeeee.hhh.....eeee....hhhhh.eeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i28 B   1 AECSVDIQGNDQMQFNTNAITVDKSCKQFxVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
                                                        30-R1A                                                                                              

Chain C from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..........eeeee....eeeeeee.....hhhhhh...eeeehhhhhhhhhhhhhhhhhhh..........ee........eeeeeee.hhh.....eeee....hhhhh.eeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i28 C   1 AECSVDIQGNDQMQFNTNAITVDKSCKQFxVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
                                                        30-R1A                                                                                              

Chain D from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..........eeeee....eeeeeee..............eeeehhhhhhhhhhhhhhhhhhh..........ee........eeeeeee.hhh.....eeee....hhhhh.eeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i28 D   1 AECSVDIQGNDQMQFNTNAITVDKSCKQFxVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
                                                        30-R1A                                                                                              

Chain E from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..........eeeee....eeeeeee.....hhhhhh...eeee..hhhhhhhhhhhhhhhhh..........ee........eeeeeee.hhh.....eeee....hhhhh.eeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i28 E   1 AECSVDIQGNDQMQFNTNAITVDKSCKQFxVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
                                                        30-R1A                                                                                              

Chain F from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..........eeeee....eeeeeee.....hhhhhh...eeee..hhhhhhhhhhhhhhhhh..........ee........eeeeeee.hhh.....eeee....hhhhh.eeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i28 F   1 AECSVDIQGNDQMQFNTNAITVDKSCKQFxVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
                                                        30-R1A                                                                                              

Chain G from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..........eeeee....eeeeeee.....hhhhhh...eeeehhhhhhhhhhhhhhhhhhh..........ee........eeeeeee.hhh.....eeee....hhhhh.eeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i28 G   1 AECSVDIQGNDQMQFNTNAITVDKSCKQFxVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
                                                        30-R1A                                                                                              

Chain H from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..........eeee.....eeeeeee.....hhhhhh...eeeehhhhhhhhhhhhhhhhhhh..........ee........eeeeeee.hhh.....eeee....hhhhh.eeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i28 H   1 AECSVDIQGNDQMQFNTNAITVDKSCKQFxVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
                                                        30-R1A                                                                                              

Chain I from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..........eeeee....eeeeeee.....hhhhhh...eeee..hhhhhhhhhhhhhhhhh..........ee........eeeeeee.hhh.....eeee....hhhhh.eeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i28 I   1 AECSVDIQGNDQMQFNTNAITVDKSCKQFxVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
                                                        30-R1A                                                                                              

Chain J from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..........eeee.....eeeeeee..............eeee..hhhhhhhhhhhhhhhhh..........ee........eeeeeee.hhh.....eeee....hhhhh.eeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i28 J   1 AECSVDIQGNDQMQFNTNAITVDKSCKQFxVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
                                                        30-R1A                                                                                              

Chain K from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..........eeeee....eeeeeee.....hhhhhh...eeeehhhhhhhhhhhhhhhhhhh..........ee........eeeeeee.hhh.....eeee....hhhhh.eeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i28 K   1 AECSVDIQGNDQMQFNTNAITVDKSCKQFxVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
                                                        30-R1A                                                                                              

Chain L from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..........eeeee....eeeeeee.....hhhhhh...eeee..hhhhhhhhhhhhhhhhh..........ee........eeeeeee.hhh.....eeee....hhhhh.eeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i28 L   1 AECSVDIQGNDQMQFNTNAITVDKSCKQFxVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
                                                        30-R1A                                                                                              

Chain M from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..........eee......eeeeeee.....hhhhhh...eeee..hhhhhhhhhhhhhhhhh..........ee........eeeeeee.........eeee....hhhhh.eeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i28 M   1 AECSVDIQGNDQMQFNTNAITVDKSCKQFxVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
                                                        30-R1A                                                                                              

Chain N from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..........eeeee....eeeeeee.....hhhhhh...eeeehhhhhhhhhhhhhhhhhhh..........ee........eeeeeee.hhh.....eeee....hhhhh.eeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i28 N   1 AECSVDIQGNDQMQFNTNAITVDKSCKQFxVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
                                                        30-R1A                                                                                              

Chain O from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..........eee......eeeeeee.....hhhhhh...eeee..hhhhhhhhhhhhhhhhh..........ee........eeeeeee.........eeee....hhhhh.eeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i28 O   1 AECSVDIQGNDQMQFNTNAITVDKSCKQFxVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
                                                        30-R1A                                                                                              

Chain P from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..........eeeee....eeeeeee.....hhhhhh...eeee..hhhhhhhhhhhhhhhhh..........ee........eeeeeee.hhh.....eeee....hhhhh.eeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i28 P   1 AECSVDIQGNDQMQFNTNAITVDKSCKQFxVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
                                                        30-R1A                                                                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5I28)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5I28)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5I28)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    R1A  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
    AG5  [ RasMol ]  +environment [ RasMol ]
    AG6  [ RasMol ]  +environment [ RasMol ]
    AG7  [ RasMol ]  +environment [ RasMol ]
    AG8  [ RasMol ]  +environment [ RasMol ]
    AG9  [ RasMol ]  +environment [ RasMol ]
    AH1  [ RasMol ]  +environment [ RasMol ]
    AH2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5i28)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]
    Biological Unit 7  [ Jena3D ]
    Biological Unit 8  [ Jena3D ]
    Biological Unit 9  [ Jena3D ]
    Biological Unit 10  [ Jena3D ]
    Biological Unit 11  [ Jena3D ]
    Biological Unit 12  [ Jena3D ]
    Biological Unit 13  [ Jena3D ]
    Biological Unit 14  [ Jena3D ]
    Biological Unit 15  [ Jena3D ]
    Biological Unit 16  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5i28
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AZUR_PSEAE | P00282
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  AZUR_PSEAE | P00282
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AZUR_PSEAE | P002821ag0 1azn 1azr 1azu 1bex 1cc3 1e5y 1e5z 1e65 1e67 1etj 1ezl 1gr7 1i53 1ils 1ilu 1jvl 1jvo 1jze 1jzf 1jzg 1jzh 1jzi 1jzj 1nzr 1r1c 1vlx 1xb3 1xb6 1xb8 2azu 2fnw 2ft6 2ft7 2ft8 2fta 2ghz 2gi0 2hx7 2hx8 2hx9 2hxa 2i7o 2i7s 2idf 2iwe 2oj1 2tsa 2tsb 2xv0 2xv2 2xv3 3azu 3fpy 3fq1 3fq2 3fqy 3fs9 3fsa 3fsv 3fsw 3fsz 3ft0 3ibo 3in0 3in2 3jt2 3jtb 3n2j 3np3 3np4 3oqr 3u25 3uge 4azu 4bww 4hhg 4hhw 4hip 4hz1 4jkn 4k9j 4ko5 4ko6 4ko7 4ko9 4kob 4koc 4mfh 4qkt 4qlw 4wkx 5azu 5i26

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5I28)