|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 2HX9) |
(no "SAP(SNP)/Variant" information available for 2HX9) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 2HX9) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:124 aligned with AZUR_PSEAE | P00282 from UniProtKB/Swiss-Prot Length:148 Alignment length:126 32 42 52 62 72 82 92 102 112 122 132 142 AZUR_PSEAE 23 CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 148 SCOP domains d2hx9a_ A: Azurin SCOP domains CATH domains 2hx9A00 A:3-127 Cupredoxins - blue copper proteins CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains Chain B from PDB Type:PROTEIN Length:125 aligned with AZUR_PSEAE | P00282 from UniProtKB/Swiss-Prot Length:148 Alignment length:128 30 40 50 60 70 80 90 100 110 120 130 140 AZUR_PSEAE 21 AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 148 SCOP domains d2hx9b_ B: Azurin SCOP domains CATH domains 2hx9B00 B:1-127 Cupredoxins - blue copper proteins CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------COPPER_BLUE ------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript 2hx9 B 1 AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLK--EQYMFFCS-PHQGAGMKGTLTLK 127 10 20 30 40 50 60 70 80 90 100 | | 110 | | 119 103 | 113 | 106 114
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 2HX9) |
Asymmetric Unit(hide GO term definitions) Chain A,B (AZUR_PSEAE | P00282)
|
|
|
|
|
|
|