|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 7)| Asymmetric/Biological Unit (4, 7) |
Sites (7, 7)
Asymmetric Unit (7, 7)
|
SS Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1JVL) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1JVL) |
PROSITE Motifs (1, 2)
Asymmetric/Biological Unit (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1JVL) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:128 aligned with AZUR_PSEAE | P00282 from UniProtKB/Swiss-Prot Length:148 Alignment length:128 30 40 50 60 70 80 90 100 110 120 130 140 AZUR_PSEAE 21 AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 148 SCOP domains d1jvla_ A: Azurin SCOP domains CATH domains 1jvlA00 A:1-128 Cupredoxins - blue copper proteins CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------COPPER_BLUE ------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript 1jvl A 1 AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKCVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128 10 20 30 40 50 60 70 80 90 100 110 120 Chain B from PDB Type:PROTEIN Length:128 aligned with AZUR_PSEAE | P00282 from UniProtKB/Swiss-Prot Length:148 Alignment length:128 30 40 50 60 70 80 90 100 110 120 130 140 AZUR_PSEAE 21 AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 148 SCOP domains d1jvlb_ B: Azurin SCOP domains CATH domains 1jvlB00 B:1-128 Cupredoxins - blue copper proteins CATH domains Pfam domains (1) Copper-bind-1jvlB01 B:1-128 Pfam domains (1) Pfam domains (2) Copper-bind-1jvlB02 B:1-128 Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------COPPER_BLUE ------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript 1jvl B 1 AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKCVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 128 10 20 30 40 50 60 70 80 90 100 110 120
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (AZUR_PSEAE | P00282)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|