Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF GTA + UDP-C-GAL + DI
 
Authors :  S. Gagnon, P. Meloncelli, R. B. Zheng, O. Haji-Ghassemi, A. R. Johal, S. N. Borisova, T. L. Lowary, S. V. Evans
Date :  17 Jun 15  (Deposition) - 23 Sep 15  (Release) - 18 Nov 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.55
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Glycosyltransferase Deoxyinhibitor Abo(H) Blood-Group System Complex, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. M. Gagnon, P. J. Meloncelli, R. B. Zheng, O. Haji-Ghassemi, A. R. Johal, S. N. Borisova, T. L. Lowary, S. V. Evans
High Resolution Structures Of The Human Abo(H) Blood Group Enzymes In Complex With Donor Analogs Reveal That The Enzymes Utilize Multiple Donor Conformations To Bind Substrates In A Stepwise Manner.
J. Biol. Chem. V. 290 27040 2015
PubMed-ID: 26374898  |  Reference-DOI: 10.1074/JBC.M115.682401

(-) Compounds

Molecule 1 - HISTO-BLOOD GROUP ABO SYSTEM TRANSFERASE
    ChainsA
    EC Number2.4.1.40, 2.4.1.37
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentUNP RESIDUES 64-354
    GeneABO
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymFUCOSYLGLYCOPROTEIN 3-ALPHA-GALACTOSYLTRANSFERASE, FUCOSYLGLYCOPROTEIN ALPHA-N-ACETYLGALACTOSAMINYLTRANSFERASE, GLYCOPROTEIN-FUCOSYLGALACTOSIDE ALPHA-N- ACETYLGALACTOSAMINYLTRANSFERASE,GLYCOPROTEIN-FUCOSYLGALACTOSIDE ALPHA-GALACTOSYLTRANSFERASE,HISTO-BLOOD GROUP A TRANSFERASE,A TRANSFERASE,HISTO-BLOOD GROUP B TRANSFERASE,B TRANSFERASE,NAGAT

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

Asymmetric Unit (3, 3)
No.NameCountTypeFull Name
1DA81Ligand/IonOCTYL 3-DEOXY-2-O-(6-DEOXY-ALPHA-L-GALACTOPYRANOSYL)-BETA-D-XYLO-HEXOPYRANOSIDE
2MN1Ligand/IonMANGANESE (II) ION
3UDP1Ligand/IonURIDINE-5'-DIPHOSPHATE
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
1DA82Ligand/IonOCTYL 3-DEOXY-2-O-(6-DEOXY-ALPHA-L-GALACTOPYRANOSYL)-BETA-D-XYLO-HEXOPYRANOSIDE
2MN-1Ligand/IonMANGANESE (II) ION
3UDP2Ligand/IonURIDINE-5'-DIPHOSPHATE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:211 , ASP A:213 , UDP A:403 , HOH A:694binding site for residue MN A 401
2AC2SOFTWAREHIS A:233 , PHE A:236 , THR A:245 , TRP A:300 , GLU A:303 , ASP A:326 , LEU A:329 , UDP A:403 , HOH A:509 , HOH A:511binding site for residue DA8 A 402
3AC3SOFTWAREPHE A:121 , ALA A:122 , ILE A:123 , TYR A:126 , VAL A:184 , ARG A:188 , ASP A:211 , VAL A:212 , ASP A:213 , MN A:401 , DA8 A:402 , HOH A:533 , HOH A:626 , HOH A:674binding site for residue UDP A 403

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5C36)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5C36)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5C36)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5C36)

(-) Exons   (0, 0)

(no "Exon" information available for 5C36)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:288
                                                                                                                                                                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....................................ee.....hhhhhhhhhhhh..eeeeeeeehhhhhhhhhhhhhhhhhhh....eeeeeeee.hhhhh........eeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhh.eeeee...eee....hhhhh..eeee........hhhhh........................eeeeehhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhh...eee.hhhh.hhhhhh.........eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5c36 A  58 AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP 345
                                    67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5C36)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5C36)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5C36)

(-) Gene Ontology  (13, 13)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DA8  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5c36)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5c36
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BGAT_HUMAN | P16442
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.4.1.37
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
  2.4.1.40
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  BGAT_HUMAN | P16442
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BGAT_HUMAN | P164421lz0 1lz7 1lzi 1lzj 1r7t 1r7u 1r7v 1r7x 1r7y 1r80 1r81 1r82 1wsz 1wt0 1wt1 1wt2 1wt3 1xz6 1zhj 1zi1 1zi3 1zi4 1zi5 1ziz 1zj0 1zj1 1zj2 1zj3 1zjo 1zjp 2a8u 2a8w 2i7b 2o1f 2o1g 2o1h 2pgv 2pgy 2rit 2rix 2riy 2riz 2rj0 2rj1 2rj4 2rj5 2rj6 2rj7 2rj8 2rj9 2y7a 3i0c 3i0d 3i0e 3i0f 3i0g 3i0h 3i0i 3i0j 3i0k 3i0l 3ioh 3ioi 3ioj 3sx3 3sx5 3sx7 3sx8 3sxa 3sxb 3sxc 3sxd 3sxe 3sxg 3u0x 3u0y 3v0l 3v0m 3v0n 3v0o 3v0p 3v0q 3zgf 3zgg 4c2s 4fqw 4fra 4frb 4frd 4fre 4frh 4frl 4frm 4fro 4frp 4frq 4gbp 4kc1 4kc2 4kc4 4kxo 4y62 4y63 4y64 5bxc 5c1g 5c1h 5c1l 5c38 5c3a 5c3b 5c3d 5c47 5c48 5c49 5c4b 5c4c 5c4d 5c4e 5c4f 5c8r 5cmf 5cmg 5cmh 5cmi 5cmj 5cql 5cqm 5cqn 5cqo 5cqp 5tjk 5tjl 5tjn 5tjo

(-) Related Entries Specified in the PDB File

5bxc 5c1g 5c1h 5c1l 5c38 5c3a 5c3b 5c3d 5c47 5c48 5c49 5c4b 5c4c 5c4d 5c4e 5c4f 5c8r