1LZJ - JenaLib

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	MET A:266 , ASP A:326 , BHG A:452 , UDP A:475 , HOH A:516 , HOH A:613 , HOH A:619 , HOH A:692 , HOH A:693	BINDING SITE FOR RESIDUE FUC A 453
2	AC2	SOFTWARE	HIS A:233 , SER A:235 , PHE A:236 , THR A:245 , TRP A:300 , GLU A:303 , FUC A:453 , UDP A:475 , HOH A:516 , HOH A:529 , HOH A:558	BINDING SITE FOR RESIDUE BHG A 452
3	AC3	SOFTWARE	THR A:119 , CYS A:209 , HOH A:719	BINDING SITE FOR RESIDUE HG A 401
4	AC4	SOFTWARE	LEU A:280 , CYS A:284 , HOH A:663	BINDING SITE FOR RESIDUE HG A 402
5	AC5	SOFTWARE	CYS A:284 , MET A:288 , ASP A:302 , HOH A:713	BINDING SITE FOR RESIDUE HG A 403
6	AC6	SOFTWARE	CYS A:209 , VAL A:210 , HOH A:629 , HOH A:661	BINDING SITE FOR RESIDUE HG A 404
7	AC7	SOFTWARE	ASP A:211 , ASP A:213 , UDP A:475 , HOH A:708	BINDING SITE FOR RESIDUE MN A 406
8	AC8	SOFTWARE	PHE A:121 , ALA A:122 , ILE A:123 , TYR A:126 , ASP A:211 , VAL A:212 , ASP A:213 , MN A:406 , BHG A:452 , FUC A:453 , HOH A:537 , HOH A:641 , HOH A:708 , HOH A:784 , HOH A:827	BINDING SITE FOR RESIDUE UDP A 475

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (21, 21)

Asymmetric Unit (21, 21)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_019149	R	63	H	BGAT_HUMAN	Polymorphism	549446	A	M	63	H
02	UniProt	VAR_019150	P	74	S	BGAT_HUMAN	Polymorphism	512770	A	P	74	S
03	UniProt	VAR_003409	P	156	L	BGAT_HUMAN	Polymorphism	1053878	A	P	156	L
04	UniProt	VAR_019151	R	161	H	BGAT_HUMAN	Polymorphism	8176738	A	R	161	H
05	UniProt	VAR_036738	T	163	M	BGAT_HUMAN	Polymorphism	55756402	A	T	163	M
06	UniProt	VAR_003410	R	176	G	BGAT_HUMAN	Polymorphism	7853989	A	G	176	G
07	UniProt	VAR_036739	R	198	W	BGAT_HUMAN	Polymorphism	56223957	A	R	198	W
08	UniProt	VAR_019152	R	199	C	BGAT_HUMAN	Polymorphism	8176739	A	R	199	C
09	UniProt	VAR_036740	M	214	R	BGAT_HUMAN	Polymorphism	55827808	A	M	214	R
10	UniProt	VAR_019153	F	216	I	BGAT_HUMAN	Polymorphism	8176740	A	F	216	I
11	UniProt	VAR_036741	E	223	D	BGAT_HUMAN	Polymorphism	---	A	E	223	D
12	UniProt	VAR_055227	G	230	R	BGAT_HUMAN	Unclassified	---	A	G	230	R
13	UniProt	VAR_072628	P	234	A	BGAT_HUMAN	Polymorphism	---	A	P	234	A
14	UniProt	VAR_003411	G	235	S	BGAT_HUMAN	Polymorphism	8176743	A	S	235	S
15	UniProt	VAR_033540	P	257	L	BGAT_HUMAN	Polymorphism	8176745	A	P	257	L
16	UniProt	VAR_003412	L	266	M	BGAT_HUMAN	Polymorphism	8176746	A	M	266	M
17	UniProt	VAR_003413	G	268	A	BGAT_HUMAN	Polymorphism	8176747	A	A	268	A
18	UniProt	VAR_033541	G	268	R	BGAT_HUMAN	Polymorphism	8176747	A	A	268	R
19	UniProt	VAR_019154	V	277	M	BGAT_HUMAN	Polymorphism	8176748	A	V	277	M
20	UniProt	VAR_036742	M	288	R	BGAT_HUMAN	Polymorphism	---	A	M	288	R
21	UniProt	VAR_036743	D	291	N	BGAT_HUMAN	Polymorphism	---	A	D	291	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (21, 21)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_019149	R	63	H	BGAT_HUMAN	Polymorphism	549446	A	M	63	H
02	UniProt	VAR_019150	P	74	S	BGAT_HUMAN	Polymorphism	512770	A	P	74	S
03	UniProt	VAR_003409	P	156	L	BGAT_HUMAN	Polymorphism	1053878	A	P	156	L
04	UniProt	VAR_019151	R	161	H	BGAT_HUMAN	Polymorphism	8176738	A	R	161	H
05	UniProt	VAR_036738	T	163	M	BGAT_HUMAN	Polymorphism	55756402	A	T	163	M
06	UniProt	VAR_003410	R	176	G	BGAT_HUMAN	Polymorphism	7853989	A	G	176	G
07	UniProt	VAR_036739	R	198	W	BGAT_HUMAN	Polymorphism	56223957	A	R	198	W
08	UniProt	VAR_019152	R	199	C	BGAT_HUMAN	Polymorphism	8176739	A	R	199	C
09	UniProt	VAR_036740	M	214	R	BGAT_HUMAN	Polymorphism	55827808	A	M	214	R
10	UniProt	VAR_019153	F	216	I	BGAT_HUMAN	Polymorphism	8176740	A	F	216	I
11	UniProt	VAR_036741	E	223	D	BGAT_HUMAN	Polymorphism	---	A	E	223	D
12	UniProt	VAR_055227	G	230	R	BGAT_HUMAN	Unclassified	---	A	G	230	R
13	UniProt	VAR_072628	P	234	A	BGAT_HUMAN	Polymorphism	---	A	P	234	A
14	UniProt	VAR_003411	G	235	S	BGAT_HUMAN	Polymorphism	8176743	A	S	235	S
15	UniProt	VAR_033540	P	257	L	BGAT_HUMAN	Polymorphism	8176745	A	P	257	L
16	UniProt	VAR_003412	L	266	M	BGAT_HUMAN	Polymorphism	8176746	A	M	266	M
17	UniProt	VAR_003413	G	268	A	BGAT_HUMAN	Polymorphism	8176747	A	A	268	A
18	UniProt	VAR_033541	G	268	R	BGAT_HUMAN	Polymorphism	8176747	A	A	268	R
19	UniProt	VAR_019154	V	277	M	BGAT_HUMAN	Polymorphism	8176748	A	V	277	M
20	UniProt	VAR_036742	M	288	R	BGAT_HUMAN	Polymorphism	---	A	M	288	R
21	UniProt	VAR_036743	D	291	N	BGAT_HUMAN	Polymorphism	---	A	D	291	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (21, 42)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_019149	R	63	H	BGAT_HUMAN	Polymorphism	549446	A	M	63	H
02	UniProt	VAR_019150	P	74	S	BGAT_HUMAN	Polymorphism	512770	A	P	74	S
03	UniProt	VAR_003409	P	156	L	BGAT_HUMAN	Polymorphism	1053878	A	P	156	L
04	UniProt	VAR_019151	R	161	H	BGAT_HUMAN	Polymorphism	8176738	A	R	161	H
05	UniProt	VAR_036738	T	163	M	BGAT_HUMAN	Polymorphism	55756402	A	T	163	M
06	UniProt	VAR_003410	R	176	G	BGAT_HUMAN	Polymorphism	7853989	A	G	176	G
07	UniProt	VAR_036739	R	198	W	BGAT_HUMAN	Polymorphism	56223957	A	R	198	W
08	UniProt	VAR_019152	R	199	C	BGAT_HUMAN	Polymorphism	8176739	A	R	199	C
09	UniProt	VAR_036740	M	214	R	BGAT_HUMAN	Polymorphism	55827808	A	M	214	R
10	UniProt	VAR_019153	F	216	I	BGAT_HUMAN	Polymorphism	8176740	A	F	216	I
11	UniProt	VAR_036741	E	223	D	BGAT_HUMAN	Polymorphism	---	A	E	223	D
12	UniProt	VAR_055227	G	230	R	BGAT_HUMAN	Unclassified	---	A	G	230	R
13	UniProt	VAR_072628	P	234	A	BGAT_HUMAN	Polymorphism	---	A	P	234	A
14	UniProt	VAR_003411	G	235	S	BGAT_HUMAN	Polymorphism	8176743	A	S	235	S
15	UniProt	VAR_033540	P	257	L	BGAT_HUMAN	Polymorphism	8176745	A	P	257	L
16	UniProt	VAR_003412	L	266	M	BGAT_HUMAN	Polymorphism	8176746	A	M	266	M
17	UniProt	VAR_003413	G	268	A	BGAT_HUMAN	Polymorphism	8176747	A	A	268	A
18	UniProt	VAR_033541	G	268	R	BGAT_HUMAN	Polymorphism	8176747	A	A	268	R
19	UniProt	VAR_019154	V	277	M	BGAT_HUMAN	Polymorphism	8176748	A	V	277	M
20	UniProt	VAR_036742	M	288	R	BGAT_HUMAN	Polymorphism	---	A	M	288	R
21	UniProt	VAR_036743	D	291	N	BGAT_HUMAN	Polymorphism	---	A	D	291	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:263
 aligned with BGAT_HUMAN | P16442 from UniProtKB/Swiss-Prot  Length:354

    Alignment length:283
                                    72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342   
           BGAT_HUMAN    63 RVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP 345
               SCOP domains d1lzja_ A: Glycosyltransferase B                                                                                                                                                                                                                                                            SCOP domains
               CATH domains 1lzjA00 A:63-345 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A                                                                                                                                                                                                               CATH domains
               Pfam domains -Glyco_transf_6-1lzjA01 A:64-345                                                                                                                                                                                                                                                            Pfam domains
         Sec.struct. author ...............................ee.....hhhhhhhhhhhh..eeeeeeeehhhhhhhhhhhhhhhhhhh....eeeeeeee.hhhhh........eeeeeee..--------------------hhhhhhhh.eeeee...eee....hhhhh..eeee........hhhhh........................eeeeehhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh...eee.hhhh.hhhhhh.........eee.. Sec.struct. author
             SAPs(SNPs) (1) H----------S---------------------------------------------------------------------------------L----H-M------------G---------------------WC--------------R-I------D------R---AS---------------------L--------M-A--------M----------R--N------------------------------------------------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------R----------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1lzj A  63 MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVG--------------------ERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP 345
                                    72        82        92       102       112       122       132       142       152       162       172   |     -         -    |  202       212       222       232       242       252       262       272       282       292       302       312       322       332       342   
                                                                                                                                           176                  197

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (13, 13)

Asymmetric Unit(hide GO term definitions)

Chain A (BGAT_HUMAN | P16442)

molecular function
	GO:0004381	fucosylgalactoside 3-alpha-galactosyltransferase activity	Catalysis of the reaction: UDP-galactose + glycoprotein-alpha-L-fucosyl-(1,2)-D-galactose = UDP + glycoprotein-alpha-D-galactosyl-(1,3)-(alpha-L-fucosyl-(1,2))-D-galactose.
	GO:0004380	glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase activity	Catalysis of the reaction: UDP-N-acetyl-D-galactosamine + glycoprotein-alpha-L-fucosyl-(1,2)-D-galactose = UDP + glycoprotein-N-acetyl-alpha-D-galactosaminyl-(1,3)-(alpha-L-fucosyl-(1,2))-D-galactose.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016757	transferase activity, transferring glycosyl groups	Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor).
	GO:0016758	transferase activity, transferring hexosyl groups	Catalysis of the transfer of a hexosyl group from one compound (donor) to another (acceptor).
biological process
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
	GO:0006486	protein glycosylation	A protein modification process that results in the addition of a carbohydrate or carbohydrate derivative unit to a protein amino acid, e.g. the addition of glycan chains to proteins.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0032580	Golgi cisterna membrane	The lipid bilayer surrounding any of the thin, flattened compartments that form the central portion of the Golgi complex.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		BHG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		FUC	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		HG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		UDP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1lzj)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1lzj
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BGAT_HUMAN \| P16442
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (5, 8)

Sites (8, 8)