Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  SMALL MOLECULE INHIBITORS OF IAP
 
Authors :  P. A. Williams
Date :  25 Oct 16  (Deposition) - 24 May 17  (Release) - 21 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A
Keywords :  Xiap, Apoptosis, Metal-Binding, Inhibitor, Ligase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. Tamanini, I. M. Buck, G. Chessari, E. Chiarparin, J. E. H. Day, M. Frederickson, C. M. Griffiths-Jones, K. Hearn, T. D. Heightman, A. Iqbal, C. N. Johnson, E. J. Lewis, V. Martins, T. Peakman, M. Reader, S. J. Rich, G. A. Ward, P. A. Williams, N. E. Wilsher
Discovery Of A Potent Nonpeptidomimetic, Small-Molecule Antagonist Of Cellular Inhibitor Of Apoptosis Protein 1 (Ciap1) And X-Linked Inhibitor Of Apoptosis Protein (Xiap).
J. Med. Chem. V. 60 4611 2017
PubMed-ID: 28492317  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.6B01877

(-) Compounds

Molecule 1 - E3 UBIQUITIN-PROTEIN LIGASE XIAP
    ChainsA
    EC Number6.3.2.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET 28B
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneXIAP, API3, BIRC4, IAP3
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymBACULOVIRAL IAP REPEAT-CONTAINING PROTEIN 4,IAP-LIKE PROTEIN,HILP,INHIBITOR OF APOPTOSIS PROTEIN 3,HIAP3,X-LINKED INHIBITOR OF APOPTOSIS PROTEIN,X-LINKED IAP

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

Asymmetric/Biological Unit (3, 3)
No.NameCountTypeFull Name
17J61Ligand/Ion1-[3,3-DIMETHYL-6-(PHENYLMETHYL)-2~{H}-PYRROLO[3,2-B]PYRIDIN-1-YL]-2-[(2~{R},5~{R})-5-METHYL-2-MORPHOLIN-4-YLCARBONYL-PIPERAZIN-4-IUM-1-YL]ETHANONE
2NA1Ligand/IonSODIUM ION
3ZN1Ligand/IonZINC ION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:300 , CYS A:303 , HIS A:320 , CYS A:327binding site for residue ZN A 401
2AC2SOFTWAREPHE A:272 , HOH A:538 , HOH A:555binding site for residue NA A 402
3AC3SOFTWARELEU A:292 , VAL A:298 , GLY A:306 , LEU A:307 , THR A:308 , ASP A:309 , TRP A:310 , LYS A:311 , GLU A:314 , GLN A:319 , TRP A:323 , TYR A:324binding site for residue 7J6 A 403

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5M6H)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5M6H)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5M6H)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5M6H)

(-) Exons   (0, 0)

(no "Exon" information available for 5M6H)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:104
                                                                                                                                        
               SCOP domains -------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhhhhhhhhh........hhhhhhhh.eee......eee.....ee.......hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 5m6h A 248 MNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEEC 351
                                   257       267       277       287       297       307       317       327       337       347    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5M6H)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5M6H)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5M6H)

(-) Gene Ontology  (32, 32)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    7J6  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5m6h)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5m6h
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  XIAP_HUMAN | P98170
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.3.2.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  XIAP_HUMAN | P98170
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        XIAP_HUMAN | P981701c9q 1f9x 1g3f 1g73 1i3o 1i4o 1i51 1kmc 1nw9 1tfq 1tft 2ecg 2jk7 2kna 2opy 2opz 2poi 2pop 2qra 2vsl 3clx 3cm2 3cm7 3eyl 3g76 3hl5 3uw4 3uw5 4ec4 4hy0 4ic2 4ic3 4j3y 4j44 4j45 4j46 4j47 4j48 4kju 4kjv 4kmp 4mtz 4oxc 4wvs 4wvt 4wvu 5c0k 5c0l 5c3h 5c3k 5c7a 5c7b 5c7c 5c7d 5c83 5c84 5m6e 5m6f 5m6l 5m6m

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5M6H)