Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CREBBP BROMODOMAIN IN COMPLEX WITH CPD59 ((S)-1-(3-((2-FLUORO-4-(1-METHYL-1H-PYRAZOL-4-YL)PHENYL)AMINO)-1-(TETRAHYDROFURAN-3-YL)-6,7-DIHYDRO-1H-PYRAZOLO[4,3-C]PYRIDIN-5(4H)-YL)ETHANONE)
 
Authors :  J. M. Murray, C. Noland
Date :  12 Jul 16  (Deposition) - 02 Nov 16  (Release) - 21 Dec 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.27
Chains :  Asym./Biol. Unit :  A
Keywords :  Crebbp Bromodomain, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. D. Crawford, F. A. Romero, K. W. Lai, V. Tsui, A. M. Taylor, G. De Leon Boenig, C. L. Noland, J. Murray, J. Ly, E. F. Choo, T. L. Hunsaker, E. W. Chan, M. Merchant, S. Kharbanda, K. E. Gascoigne, S. Kaufman, M. H. Beresini, J. Liao, W. Liu, K. X. Chen, Z. Chen, A. R. Conery, A. Cote, H. Jayaram, Y. Jiang, J. R. Kiefer, T. Kleinheinz Y. Li, J. Maher, E. Pardo, F. Poy, K. L. Spillane, F. Wang, J. Wang, X. Wei Z. Xu, Z. Xu, I. Yen, L. Zawadzke, X. Zhu, S. Bellon, R. Cummings, A. G. Cochran, B. K. Albrecht, S. Magnuson
Discovery Of A Potent And Selective In Vivo Probe (Gne-272) For The Bromodomains Of Cbp/Ep300.
J. Med. Chem. V. 59 10549 2016
PubMed-ID: 27682507  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.6B01022

(-) Compounds

Molecule 1 - CREB-BINDING PROTEIN
    ChainsA
    EC Number2.3.1.48
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentBROMODOMAIN (UNP RESIDUES 1085-1196)
    GeneCREBBP, CBP
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 4)

Asymmetric/Biological Unit (3, 4)
No.NameCountTypeFull Name
16XH1Ligand/Ion1-[3-[[2-FLUORANYL-4-(1-METHYLPYRAZOL-4-YL)PHENYL]AMINO]-1-[(3~{S})-OXOLAN-3-YL]-6,7-DIHYDRO-4~{H}-PYRAZOLO[4,3-C]PYRIDIN-5-YL]ETHANONE
2DMS1Ligand/IonDIMETHYL SULFOXIDE
3EDO2Ligand/Ion1,2-ETHANEDIOL

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:1109 , PRO A:1110 , LEU A:1120 , ILE A:1122 , TRP A:1165 , ASN A:1168 , ARG A:1173 , VAL A:1174 , PHE A:1177 , SER A:1179 , GLU A:1186 , HOH A:1316 , HOH A:1394 , HOH A:1400binding site for residue 6XH A 1201
2AC2SOFTWAREGLN A:1104 , ASP A:1105 , GLU A:1107 , HOH A:1313 , HOH A:1363binding site for residue EDO A 1202
3AC3SOFTWAREARG A:1091 , MET A:1095 , PRO A:1096 , ASP A:1124 , HOH A:1324 , HOH A:1369 , HOH A:1385binding site for residue EDO A 1203
4AC4SOFTWARETRP A:1151 , LYS A:1170 , THR A:1171 , MET A:1193 , HOH A:1360binding site for residue DMS A 1204

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5KTX)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Asp A:1105 -Pro A:1106

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5KTX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5KTX)

(-) Exons   (0, 0)

(no "Exon" information available for 5KTX)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:114
                                                                                                                                                   
               SCOP domains ------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh....hhhhh...hhhhhh..hhhhhh....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                5ktx A 1083 AAFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQAL 1196
                                  1092      1102      1112      1122      1132      1142      1152      1162      1172      1182      1192    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5KTX)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5KTX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5KTX)

(-) Gene Ontology  (66, 66)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    6XH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DMS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asp A:1105 - Pro A:1106   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ktx
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CBP_HUMAN | Q92793
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.48
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CBP_HUMAN | Q92793
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CBP_HUMAN | Q927931jsp 1liq 1rdt 1wo3 1wo4 1wo5 1wo6 1wo7 1zoq 2d82 2kje 2kwf 2l84 2l85 2lxs 2lxt 2n1a 2rny 3dwy 3p1c 3p1d 3p1e 3p1f 3svh 4a9k 4n3w 4n4f 4nr4 4nr5 4nr6 4nr7 4nyv 4nyw 4nyx 4ouf 4tqn 4ts8 4whu 4yk0 5cgp 5dbm 5eic 5eng 5ep7 5gh9 5h85 5i83 5i86 5i89 5i8b 5i8g 5j0d 5jem 5ktu 5ktw 5mpz 5mqe 5mqg 5mqk 5tb6

(-) Related Entries Specified in the PDB File

5ktw 5ku3