2KJE - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - model 1, sites (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   NMR STRUCTURE OF CBP TAZ2 AND ADENOVIRAL E1A COMPLEX

Authors :   J. C. Ferreon, M. Martinez-Yamout, H. Dyson, P. E. Wright

Date :   27 May 09 (Deposition) - 15 Sep 09 (Release) - 15 Sep 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A,B  (20x)

Keywords :   Cbp, Taz2, E1A, Adenoviral, Acetylation, Activator, Bromodomain, Chromosomal Rearrangement, Disease Mutation, Host-Virus Interaction, Isopeptide Bond, Metal-Binding, Methylation, Nucleus, Phosphoprotein, Transcription, Transcription Regulation, Transferase, Ubl Conjugation, Zinc, Zinc-Finger, Alternative Splicing, Dna-Binding, Early Protein, Oncogene (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. C. Ferreon, M. A. Martinez-Yamout, H. J. Dyson, P. E. Wright
Structural Basis For Subversion Of Cellular Control Mechanisms By The Adenoviral E1A Oncoprotein.
Proc. Natl. Acad. Sci. Usa V. 106 13260 2009
PubMed-ID: 19651603 | Reference-DOI: 10.1073/PNAS.0906770106
(for further references see the PDB file header)

Molecule 1 - CREB-BINDING PROTEIN
	Chains	:	A
	EC Number	:	2.3.1.48
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET21A
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 1763-1854
	Gene	:	CREBBP, CBP
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

Molecule 2 - EARLY E1A 32 KDA PROTEIN
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET21A
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 53-91
	Organism Common	:	ADENOVIRUS
	Organism Scientific	:	HUMAN ADENOVIRUS 5
	Organism Taxid	:	28285


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

NMR Structure (1, 3)

No.	Name	Count	Type	Full Name
1	ZN	3	Ligand/Ion	ZINC ION

NMR Structure (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HIS A:1782 , CYS A:1786 , CYS A:1791 , CYS A:1796	BINDING SITE FOR RESIDUE ZN A 500
2	AC2	SOFTWARE	HIS A:1805 , CYS A:1809 , CYS A:1817 , CYS A:1820	BINDING SITE FOR RESIDUE ZN A 501
3	AC3	SOFTWARE	HIS A:1830 , CYS A:1834 , CYS A:1839 , CYS A:1844	BINDING SITE FOR RESIDUE ZN A 502

(no "SS Bond" information available for 2KJE)

(no "Cis Peptide Bond" information available for 2KJE)

NMR Structure (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_078559	R	1786	P	CBP_HUMAN	Disease	---	A	R	1787	P
2	UniProt	VAR_078560	C	1819	F	CBP_HUMAN	Disease	---	A	C	1820	F
3	UniProt	VAR_078561	C	1826	W	CBP_HUMAN	Disease	---	A	C	1827	W
4	UniProt	VAR_078562	C	1838	Y	CBP_HUMAN	Disease	---	A	C	1839	Y

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ZF_TAZ	PS50134	Zinc finger TAZ-type profile.	CBP_HUMAN	347-433 1765-1846	1	- A:1766-1847

NMR Structure (1, 1)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000262367	1a	ENSE00001871332	chr16:3930722-3929833	890	CBP_HUMAN	1-29	29	0	-	-
1.2	ENST00000262367	2	ENSE00001789080	chr16:3901010-3900298	713	CBP_HUMAN	29-266	238	0	-	-
1.3	ENST00000262367	3	ENSE00001788865	chr16:3860780-3860604	177	CBP_HUMAN	267-325	59	0	-	-
1.4	ENST00000262367	4	ENSE00001744566	chr16:3843627-3843387	241	CBP_HUMAN	326-406	81	0	-	-
1.5	ENST00000262367	5	ENSE00001693899	chr16:3842095-3841982	114	CBP_HUMAN	406-444	39	0	-	-
1.6	ENST00000262367	6	ENSE00001692816	chr16:3832927-3832685	243	CBP_HUMAN	444-525	82	0	-	-
1.7	ENST00000262367	7	ENSE00001608958	chr16:3831307-3831205	103	CBP_HUMAN	525-559	35	0	-	-
1.8	ENST00000262367	8	ENSE00001732416	chr16:3830879-3830733	147	CBP_HUMAN	559-608	50	0	-	-
1.9	ENST00000262367	9	ENSE00001656158	chr16:3828818-3828701	118	CBP_HUMAN	608-647	40	0	-	-
1.10	ENST00000262367	10	ENSE00001678454	chr16:3828183-3828012	172	CBP_HUMAN	648-705	58	0	-	-
1.11	ENST00000262367	11	ENSE00001615007	chr16:3827658-3827614	45	CBP_HUMAN	705-720	16	0	-	-
1.12	ENST00000262367	12	ENSE00001733259	chr16:3824694-3824570	125	CBP_HUMAN	720-761	42	0	-	-
1.13	ENST00000262367	13	ENSE00001638447	chr16:3823931-3823752	180	CBP_HUMAN	762-821	60	0	-	-
1.14	ENST00000262367	14	ENSE00001594624	chr16:3820987-3820571	417	CBP_HUMAN	822-960	139	0	-	-
1.15	ENST00000262367	15	ENSE00001625302	chr16:3819354-3819175	180	CBP_HUMAN	961-1020	60	0	-	-
1.16	ENST00000262367	16	ENSE00001784635	chr16:3817910-3817721	190	CBP_HUMAN	1021-1084	64	0	-	-
1.17	ENST00000262367	17	ENSE00001709420	chr16:3808973-3808855	119	CBP_HUMAN	1084-1123	40	0	-	-
1.18	ENST00000262367	18	ENSE00001644140	chr16:3808049-3807810	240	CBP_HUMAN	1124-1203	80	0	-	-
1.19	ENST00000262367	19	ENSE00001699420	chr16:3807377-3807289	89	CBP_HUMAN	1204-1233	30	0	-	-
1.20	ENST00000262367	20	ENSE00001592013	chr16:3801807-3801727	81	CBP_HUMAN	1233-1260	28	0	-	-
1.21	ENST00000262367	21	ENSE00001789918	chr16:3799684-3799628	57	CBP_HUMAN	1260-1279	20	0	-	-
1.22	ENST00000262367	22	ENSE00001670717	chr16:3795355-3795278	78	CBP_HUMAN	1279-1305	27	0	-	-
1.23	ENST00000262367	23	ENSE00001684253	chr16:3794962-3794895	68	CBP_HUMAN	1305-1328	24	0	-	-
1.24	ENST00000262367	24	ENSE00001804031	chr16:3790550-3790400	151	CBP_HUMAN	1328-1378	51	0	-	-
1.25	ENST00000262367	25	ENSE00001623920	chr16:3789725-3789579	147	CBP_HUMAN	1378-1427	50	0	-	-
1.26	ENST00000262367	26	ENSE00001698951	chr16:3788673-3788560	114	CBP_HUMAN	1427-1465	39	0	-	-
1.27	ENST00000262367	27	ENSE00000894975	chr16:3786816-3786651	166	CBP_HUMAN	1465-1520	56	0	-	-
1.28	ENST00000262367	28	ENSE00000894970	chr16:3786204-3786037	168	CBP_HUMAN	1521-1576	56	0	-	-
1.29	ENST00000262367	29	ENSE00001062588	chr16:3781938-3781777	162	CBP_HUMAN	1577-1630	54	0	-	-
1.30	ENST00000262367	30	ENSE00000865712	chr16:3781474-3781193	282	CBP_HUMAN	1631-1724	94	0	-	-
1.31	ENST00000262367	31	ENSE00001292463	chr16:3779875-3775055	4821	CBP_HUMAN	1725-2442	718	1	A:1764-1855	92

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:92
 aligned with CBP_HUMAN | Q92793 from UniProtKB/Swiss-Prot  Length:2442

    Alignment length:92
                                  1772      1782      1792      1802      1812      1822      1832      1842      1852  
           CBP_HUMAN   1763 SPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQ 1854
               SCOP domains d2kjea_ A: CREB-binding transcriptional adaptor protein CBP (p300)                           SCOP domains
               CATH domains 2kjeA00 A:1764-1855 CREB-binding Protein; Chain A                                            CATH domains
               Pfam domains -------zf-TAZ-2kjeA01 A:1771-1844                                                ----------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -----------------------P--------------------------------F------W-----------Y---------------- SAPs(SNPs)
                    PROSITE --ZF_TAZ  PDB: A:1766-1847 UniProt: 1765-1846                                       -------- PROSITE
               Transcript 1 Exon 1.31  PDB: A:1764-1855 UniProt: 1725-2442 [INCOMPLETE]                                  Transcript 1
                2kje A 1764 SPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQ 1855
                                  1773      1783      1793      1803      1813      1823      1833      1843      1853

Chain B from PDB  Type:PROTEIN  Length:42
 aligned with E1A_ADE05 | P03255 from UniProtKB/Swiss-Prot  Length:289

    Alignment length:56
                                    45        55        65        75        85      
           E1A_ADE05     36 SHFEPPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAVQEGIDLLTFPPAPGSPE   91
               SCOP domains -------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------- CATH domains
               Pfam domains -------------------Adeno_E1A-2kjeB01 B:55-91             Pfam domains
         Sec.struct. author .....--------------...hhhhhhh......hhhhh...hhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                2kje B   50 SHMAP--------------EDPNEEAVSQIFPDSVMLAVQEGIDLLTFPPAPGSPE   91
                                |    -        55        65        75        85      
                               54             55

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Small proteins (3458)

Fold: TAZ domain (11)

Superfamily: TAZ domain (11)

Family: TAZ domain (11)

Protein domain: CREB-binding transcriptional adaptor protein CBP (p300) (9)

Human (Homo sapiens) [TaxId: 9606] (3)

d2kjea_

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: CREB-binding Protein; Chain A (10)

Homologous Superfamily: CREB-binding Protein; Chain A (10)

Human (Homo sapiens) (5)

2kjeA00

A:1764-1855

NMR Structure(hide GO term definitions)

Chain A (CBP_HUMAN | Q92793)

molecular function
	GO:0043426	MRF binding	Interacting selectively and non-covalently with Myogenic Regulatory Factor (MRF), a member of the basic Helix-Loop-Helix (bHLH) superfamily of transcription factors.
	GO:0001102	RNA polymerase II activating transcription factor binding	Interacting selectively and non-covalently with an RNA polymerase II transcription activating factor, a protein involved in positive regulation of transcription.
	GO:0001105	RNA polymerase II transcription coactivator activity	Interacting selectively and non-covalently with an RNA polymerase II (RNAP II) regulatory transcription factor and also with the RNAP II basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind DNA, but rather mediate protein-protein interactions between activating transcription factors and the basal RNAP II transcription machinery.
	GO:0001085	RNA polymerase II transcription factor binding	Interacting selectively and non-covalently with an RNA polymerase II transcription factor, any protein required to initiate or regulate transcription by RNA polymerase II.
	GO:0046332	SMAD binding	Interacting selectively and non-covalently with a SMAD signaling protein.
	GO:0016407	acetyltransferase activity	Catalysis of the transfer of an acetyl group to an acceptor molecule.
	GO:0033613	activating transcription factor binding	Interacting selectively and non-covalently with an activating transcription factor, any protein whose activity is required to initiate or upregulate transcription.
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0000987	core promoter proximal region sequence-specific DNA binding	Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to the core promoter. The transcribed region might be described as a gene, cistron, or operon.
	GO:0003684	damaged DNA binding	Interacting selectively and non-covalently with damaged DNA.
	GO:0004402	histone acetyltransferase activity	Catalysis of the reaction: acetyl-CoA + histone = CoA + acetyl-histone.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0002039	p53 binding	Interacting selectively and non-covalently with one of the p53 family of proteins.
	GO:0034212	peptide N-acetyltransferase activity	Catalysis of the acetylation of an amino acid residue of a peptide or protein, according to the reaction: acetyl-CoA + peptide = CoA + N-acetylpeptide.
	GO:0042975	peroxisome proliferator activated receptor binding	Interacting selectively and non-covalently with any of the peroxisome proliferator activated receptors, alpha, beta or gamma.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004871	signal transducer activity	Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
	GO:0003713	transcription coactivator activity	Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
	GO:0003712	transcription cofactor activity	Interacting selectively and non-covalently with a regulatory transcription factor and also with the basal transcription machinery in order to modulate transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between regulatory transcription factors and the basal transcription machinery.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0001078	transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding	Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to stop, prevent, or reduce the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0001191	transcriptional repressor activity, RNA polymerase II transcription factor binding	Interacting selectively and non-covalently with an RNA polymerase II transcription factor, which may be a single protein or a complex, in order to stop, prevent, or reduce the frequency, rate or extent of transcription from an RNA polymerase II promoter. A protein binding transcription factor may or may not also interact with the template nucleic acid (either DNA or RNA) as well.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016746	transferase activity, transferring acyl groups	Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0018076	N-terminal peptidyl-lysine acetylation	The acetylation of the N-terminal lysine of proteins.
	GO:0007219	Notch signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:1904837	beta-catenin-TCF complex assembly	The aggregation, arrangement and bonding together of a set of components to form a beta-catenin-TCF complex.
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0098609	cell-cell adhesion	The attachment of one cell to another cell via adhesion molecules.
	GO:0044255	cellular lipid metabolic process	The chemical reactions and pathways involving lipids, as carried out by individual cells.
	GO:0034644	cellular response to UV	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers.
	GO:0042733	embryonic digit morphogenesis	The process, occurring in the embryo, by which the anatomical structures of the digit are generated and organized. A digit is one of the terminal divisions of an appendage, such as a finger or toe.
	GO:0016573	histone acetylation	The modification of a histone by the addition of an acetyl group.
	GO:0042592	homeostatic process	Any biological process involved in the maintenance of an internal steady state.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:1900087	positive regulation of G1/S transition of mitotic cell cycle	Any cell cycle regulatory process that promotes the commitment of a cell from G1 to S phase of the mitotic cell cycle.
	GO:1901224	positive regulation of NIK/NF-kappaB signaling	Any process that activates or increases the frequency, rate or extent of NIK/NF-kappaB signaling.
	GO:0060355	positive regulation of cell adhesion molecule production	Any process that increases the rate, frequency or extent of cell adhesion molecule production. Cell adhesion molecule production is the appearance of a cell adhesion molecule as a result of its biosynthesis or a decrease in its catabolism.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0032481	positive regulation of type I interferon production	Any process that activates or increases the frequency, rate, or extent of type I interferon production. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
	GO:0006473	protein acetylation	The addition of an acetyl group to a protein amino acid. An acetyl group is CH3CO-, derived from acetic [ethanoic] acid.
	GO:0006461	protein complex assembly	The aggregation, arrangement and bonding together of a set of components to form a protein complex.
	GO:0042981	regulation of apoptotic process	Any process that modulates the occurrence or rate of cell death by apoptotic process.
	GO:1900034	regulation of cellular response to heat	Any process that modulates the frequency, rate or extent of cellular response to heat.
	GO:0008589	regulation of smoothened signaling pathway	Any process that modulates the frequency, rate or extent of smoothened signaling.
	GO:0061418	regulation of transcription from RNA polymerase II promoter in response to hypoxia	Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of a hypoxia stimulus.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0001666	response to hypoxia	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
	GO:0070555	response to interleukin-1	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-1 stimulus.
	GO:0048511	rhythmic process	Any process pertinent to the generation and maintenance of rhythms in the physiology of an organism.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0002223	stimulatory C-type lectin receptor signaling pathway	Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
	GO:0006367	transcription initiation from RNA polymerase II promoter	Any process involved in the assembly of the RNA polymerase II preinitiation complex (PIC) at an RNA polymerase II promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0000123	histone acetyltransferase complex	A protein complex that possesses histone acetyltransferase activity.
	GO:0016604	nuclear body	Extra-nucleolar nuclear domains usually visualized by confocal microscopy and fluorescent antibodies to specific proteins.
	GO:0000790	nuclear chromatin	The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0005667	transcription factor complex	A protein complex that is capable of associating with DNA by direct binding, or via other DNA-binding proteins or complexes, and regulating transcription.

Chain B (E1A_ADE05 | P03255)

molecular function
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0030683	evasion or tolerance by virus of host immune response	Any process, either active or passive, by which a virus avoids the effects of the host organism's immune response. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0039645	modulation by virus of host G1/S transition checkpoint	Any viral process that modulates the frequency, rate or extent of the host cell G1/S transition checkpoint.
	GO:0060153	modulation by virus of host cell cycle	Any viral process that modulates the rate or extent of progression through the cell cycle.
	GO:0019048	modulation by virus of host morphology or physiology	The process in which a virus effects a change in the structure or processes of its host organism.
	GO:0039648	modulation by virus of host protein ubiquitination	Any process in which a virus modulates the frequency, rate or extent of protein ubiquitination in the host organism. Ubiquitination is the process in which one or more ubiquitin groups are added to a protein.
	GO:0039649	modulation by virus of host ubiquitin-protein ligase activity	The process in which a virus effects a change in host ubiquitin-protein ligase activity. Ubiquitin-protein ligase activity catalyzes the reaction: ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0039563	suppression by virus of host STAT1 activity	Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of host STAT1 (signal transducer and activator of transcription-1) activity. STATs are SH2 domain-containing proteins which lie downstream of many signaling receptors. Upon phosphorylation by JAKs, STAT proteins hetero- or homo-dimerize and translocate to the nucleus to activate transcription of target genes.
	GO:0039657	suppression by virus of host gene expression	Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of gene expression in the host organism. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA (for protein-coding genes) and the translation of that mRNA into protein. Some protein processing events may be included when they are required to form an active form of a product from an inactive precursor form.
	GO:0039503	suppression by virus of host innate immune response	Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of the innate immune response of the host organism, the host's first line of defense.
	GO:0039502	suppression by virus of host type I interferon-mediated signaling pathway	Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of type I interferon-mediated signaling in the host organism. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0042025	host cell nucleus	A membrane-bounded organelle as it is found in the host cell in which chromosomes are housed and replicated. The host is defined as the larger of the organisms involved in a symbiotic interaction.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kje)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - model 1, sites PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2kje
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CBP_HUMAN \| Q92793
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	E1A_ADE05 \| P03255
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.3.1.48
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CBP_HUMAN \| Q92793
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	E1A_ADE05 \| P03255
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 2KJE)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 3)

Sites (3, 3)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 4)

PROSITE Motifs (1, 1)

Exons (1, 1)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (2, 2)

Gene Ontology (78, 83)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File