Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE LEGIONELLA PNEUMOPHILA EFFECTOR PROTEIN RAVZ - P6322
 
Authors :  D. H. Kwon, L. Kim, B. -W. Kim, S. B. Hong, H. K. Song
Date :  03 Feb 16  (Deposition) - 09 Nov 16  (Release) - 17 May 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.55
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A  (2x)
Keywords :  Autophagy, Atg8, Deconjugating Enzyme, Protease, Atg4B, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. H. Kwon, S. Kim, Y. O. Jung, K. H. Roh, L. Kim, B. -W. Kim, S. B. Hong, I. Y. Lee, J. H. Song, W. C. Lee, E. J. Choi, K. Y. Hwang, H. K. Song
The 1:2 Complex Between Ravz And Lc3 Reveals A Mechanism Fo Deconjugation Of Lc3 On The Phagophore Membrane
Autophagy V. 13 70 2017
PubMed-ID: 27791457  |  Reference-DOI: 10.1080/15548627.2016.1243199

(-) Compounds

Molecule 1 - UNCHARACTERIZED PROTEIN RAVZ
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 49-502
    Gene: LPG1683
    Mutation: YES
    Organism Scientific: LEGIONELLA PNEUMOPHILA SUBSP. PNEUMOPHILA STRAIN PHILADELPHIA 1
    Organism Taxid: 272624
    Strain: PHILADELPHIA 1

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (1x): A
Biological Unit 2 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5HZY)

(-) Sites  (0, 0)

(no "Site" information available for 5HZY)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5HZY)

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1Glu A:92 -Asp A:93
2Asp A:93 -Lys A:94
3Ser A:188 -Lys A:189
4Glu A:255 -Gly A:256
5Gln A:346 -Ser A:347
6Gly A:378 -Lys A:379
7Lys A:379 -Asn A:380
8Asp A:429 -Asp A:430

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5HZY)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5HZY)

(-) Exons   (0, 0)

(no "Exon" information available for 5HZY)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:380
                                                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........ee......hhhhh.hhhhhhhhhhhhhh..........eee........eeeeee.....eeeee......eeee........eeehhhhhhhhhhhhhhhhh....eeeeeeeeeee........eeeeeeeeee....eeeeeeee......hhhhh....hhhhhhhhhhhhhh....ee...eeee..........hhhhhhhhhhhhhhhhhhh.....ee..ee.hhhhhhhhhhhhhhhhhhhhh.eehhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh...eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhh..ee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hzy A  39 HHENLYFQGSSIYPPETSWEVNKGMNSSRLHKLYSLFFDKSSAFYLGDDVSVLEDKPLTGAYGFQSKKNDQQIFLFRPDSDYVAGYHVDAKSDAGWVNDKLDRRLSEISEFCSKATQPATFILPFVEMPTDITKGVQHQVLLTISYDPKSKQLTPTVYDSISLSSYFKGKYRTTCDEILTQSIEKAIKSTDFTLGKFTRAAYNHQNRLTEGNSGSYTFRTIKEVISSSAQGTEVKIPGSGYITSNSYLTSQHVQDIESCIKYRNLGVVDIESALTEGKTLPVQLSEFIVALEDYGKLRSQQSEGYSKTAKLTAVELLIGILNDIKGKNEISESQYDKLVKEVDCLMDSSLGKLVQFHLKNLGAESLQKLVLPCVKFDDTI 432
                                    48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198||     215       225       235       245       255       265       275       285       295       305       315       325       335       345  ||   362       372       382       392       402       412       422       432
                                                                                                                                                                                          199|                                                                                                                                          348|                                                                            
                                                                                                                                                                                           207                                                                                                                                           356
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5HZY)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5HZY)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5HZY)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5HZY)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5hzy)
 
  Sites
(no "Sites" information available for 5hzy)
 
  Cis Peptide Bonds
    Asp A:429 - Asp A:430   [ RasMol ]  
    Asp A:93 - Lys A:94   [ RasMol ]  
    Gln A:346 - Ser A:347   [ RasMol ]  
    Glu A:255 - Gly A:256   [ RasMol ]  
    Glu A:92 - Asp A:93   [ RasMol ]  
    Gly A:378 - Lys A:379   [ RasMol ]  
    Lys A:379 - Asn A:380   [ RasMol ]  
    Ser A:188 - Lys A:189   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5hzy
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5ZUV9_LEGPH | Q5ZUV9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q5ZUV9_LEGPH | Q5ZUV9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q5ZUV9_LEGPH | Q5ZUV9: 5cqc 5io3 5izv 5ms2 5ms5 5ms7 5ms8

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5HZY)