Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF E.COLI FRUCTOSE 1,6-BISPHOSPHATE ALDOLASE, CITRATE BOUND FORM
 
Authors :  T. H. Tran, K. H. Huynh, T. H. Ho, L. W. Kang
Date :  03 Jul 16  (Deposition) - 05 Jul 17  (Release) - 05 Jul 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Fba Citrate Bound Aldolase Ec 4. 1. 2. 13 Fructose 1, 6-Bisphosphate Glycolysis Anabolic Pathways Catabolic Pathways, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. H. Tran, K. H. Huynh, T. H. Ho, L. W. Kang
Structure Of E. Coli Fructose 1, 6-Bisphosphate Aldolase, Citrate Bound Form
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - FRUCTOSE-BISPHOSPHATE ALDOLASE CLASS 2
    Chains: A, B
    EC Number: 4.1.2.13
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Taxid: 469008
    Gene: FBAA, FBA, FDA, B2925, JW2892
    Organism Scientific: ESCHERICHIA COLI (STRAIN K12)
    Organism Taxid: 83333
    Strain: K12
    Synonym: FBPA,FRUCTOSE-1,6-BISPHOSPHATE ALDOLASE,FRUCTOSE- BISPHOSPHATE ALDOLASE CLASS II

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 5)

Asymmetric/Biological Unit (3, 5)
No.NameCountTypeFull Name
1CIT2Ligand/IonCITRIC ACID
2PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
3ZN2Ligand/IonZINC ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:110 , HIS A:264 , CIT A:402 , HOH A:533binding site for residue ZN A 401
2AC2SOFTWAREHIS A:110 , HIS A:264 , GLY A:265 , ZN A:401 , HOH A:506 , HOH A:521 , HOH A:533 , HOH A:588binding site for residue CIT A 402
3AC3SOFTWARESER A:88 , HIS A:91 , HIS A:92 , SER B:88 , HIS B:91 , HIS B:92 , GLN B:95binding site for residue PEG A 403
4AC4SOFTWAREHIS B:110 , HIS B:264 , CIT B:402 , HOH B:535binding site for residue ZN B 401
5AC5SOFTWAREHIS B:110 , HIS B:264 , GLY B:265 , ZN B:401 , HOH B:505 , HOH B:521 , HOH B:535 , HOH B:537binding site for residue CIT B 402

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5GK6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5GK6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5GK6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5GK6)

(-) Exons   (0, 0)

(no "Exon" information available for 5GK6)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:333
                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh...ee..hhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhhh..eeeeehhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh.eeeeee...hhhhhhhhhhhhhhhhhhhhhhh.....eeee.....hhhhhhhhhhhhhhhhhh...eeeee.......hhhhhhhhhhhhh.....eeee.........hhhhhhhhhhhhhhh........eee......hhhhhhhhhhh.eeeeeehhhhhhhhhhhhhhhhhhhhhhh...eee..eeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5gk6 A   1 SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTLYTQPEDVDYAYTELSKISPRFTIAASFGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL 358
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       196       206       216       235       245       255       265       275       285       295       305       315       325       335       345       355   
                                                                                                                                                                                                           178|                          224|                                                                                                                            
                                                                                                                                                                                                            195                           234                                                                                                                            


Chain B from PDB  Type:PROTEIN  Length:331
                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh...ee..hhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhhh..eeeeehhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh.eeeeee...hhhhhhhhhhhhhhhhhhhhhhh.....eeee.....hhhhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhh....eeee........hhhhhhhhhhhhhhhh.......eee......hhhhhhhhhhh.eeeeeehhhhhhhhhhhhhhhhhhhhhhh...eee..eeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5gk6 B   1 SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCLYTQPEDVDYAYTELSKISPRFTIAASFGNVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL 358
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170      |197       207       217      |237       247       257       267       277       287       297       307       317       327       337       347       357 
                                                                                                                                                                                                          177|                          224|                                                                                                                           
                                                                                                                                                                                                           195                           235
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5GK6)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5GK6)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5GK6)

(-) Gene Ontology  (13, 13)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CIT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5gk6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5gk6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ALF_ECOLI | P0AB71
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.1.2.13
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ALF_ECOLI | P0AB71
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ALF_ECOLI | P0AB71: 1b57 1dos 1gyn 1zen 5gk3 5gk4 5gk5 5gk7 5gk8

(-) Related Entries Specified in the PDB File

5gk3 5gk4 5gk5 5gk7 5gk8