Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  NATIVE STRUCTURE OF FRUCTOSE 1,6-BISPHOSPHATE ALDOLASE FROM ESCHERICHIA COLI AT 2.0 ANGSTROM RESOLUTION
 
Authors :  T. H. Tran, K. H. Huynh, T. H. Ho, L. W. Kang
Date :  03 Jul 16  (Deposition) - 05 Jul 17  (Release) - 05 Jul 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Aldolase Ec 4. 1. 2. 13 Fructose 1, 6-Bisphosphate Glycolysis Anabolic Pathways Catabolic Pathways, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. H. Tran, K. H. Huynh, T. H. Ho, L. W. Kang
Apo Structure Of Fructose 1, 6-Bisphosphate Aldolase From Escherichia Coli At 2. 0 Angstrom Resolution
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - FRUCTOSE-BISPHOSPHATE ALDOLASE CLASS 2
    Chains: A, B
    EC Number: 4.1.2.13
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Taxid: 469008
    Gene: FBAA, FBA, FDA, B2925, JW2892
    Organism Scientific: ESCHERICHIA COLI (STRAIN K12)
    Organism Taxid: 83333
    Strain: K12
    Synonym: FBPA,FRUCTOSE-1,6-BISPHOSPHATE ALDOLASE,FRUCTOSE- BISPHOSPHATE ALDOLASE CLASS II

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 7)

Asymmetric/Biological Unit (3, 7)
No.NameCountTypeFull Name
1GOL2Ligand/IonGLYCEROL
2PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
3ZN4Ligand/IonZINC ION

(-) Sites  (7, 7)

Asymmetric Unit (7, 7)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN A:18 , TYR A:206 , PRO A:214 , PHE A:216 , SER A:258 , LEU A:259 , ASN A:260 , HOH A:526 , HOH A:574 , HOH A:599binding site for residue GOL A 401
2AC2SOFTWARETYR A:160binding site for residue GOL A 402
3AC3SOFTWAREHIS A:110 , GLU A:174 , HIS A:264 , HOH A:534 , HOH A:629binding site for residue ZN A 403
4AC4SOFTWAREHIS A:110 , HIS A:264 , HOH A:560 , HOH A:652 , HOH A:656 , HOH A:658binding site for residue ZN A 404
5AC5SOFTWARESER A:88 , HIS A:91 , HIS A:92 , GLN A:95 , SER B:88 , HIS B:91 , HIS B:92 , GLN B:95binding site for residue PEG A 405
6AC6SOFTWAREHIS B:110 , GLU B:174 , HIS B:264 , HOH B:534 , HOH B:606 , HOH B:682binding site for residue ZN B 401
7AC7SOFTWAREHIS B:110 , HIS B:264 , HOH B:550 , HOH B:673 , HOH B:674 , HOH B:682binding site for residue ZN B 402

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5GK4)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5GK4)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5GK4)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5GK4)

(-) Exons   (0, 0)

(no "Exon" information available for 5GK4)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:329
                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh...ee..hhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhhh..eeeeehhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh.eeeeee...hhhhhhhhhhhhhhhhhhhhhhh.....eeee.....hhhhhhhhhhhhhhhhhh...eeeeee..hhhhhhhhhhhhhh....eeeeee.......hhhhhhhhhhhhhhh........eee......hhhhhhhhhhh.eeeeeehhhhhhhhhhhhhhhhhhhhhhh...eee..eeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5gk4 A   1 SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELYTQPEDVDYAYTELSKISPRFTIAASFGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL 358
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170    || 200       210       220   ||  239       249       259       269       279       289       299       309       319       329       339       349         
                                                                                                                                                                                                        175|                         224|                                                                                                                            
                                                                                                                                                                                                         196                          234                                                                                                                            


Chain B from PDB  Type:PROTEIN  Length:330
                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhh...ee..hhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhhh..eeeeehhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh.eeeeee...hhhhhhhhhhhhhhhhhhhhhhh.....eee......hhhhhhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhh....eeee.........hhhhhhhhhhhhhhhh.......eee......hhhhhhhhhhh.eeeeeehhhhhhhhhhhhhhhhhhhhhhh...eee..eeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5gk4 B   1 SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGYTQPEDVDYAYTELSKISPRFTIAASFGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL 358
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     ||199       209       219     ||238       248       258       268       278       288       298       308       318       328       338       348       358
                                                                                                                                                                                                         176|                          225|                                                                                                                           
                                                                                                                                                                                                          196                           235
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5GK4)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5GK4)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5GK4)

(-) Gene Ontology  (13, 13)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5gk4)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5gk4
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ALF_ECOLI | P0AB71
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.1.2.13
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ALF_ECOLI | P0AB71
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ALF_ECOLI | P0AB71: 1b57 1dos 1gyn 1zen 5gk3 5gk5 5gk6 5gk7 5gk8

(-) Related Entries Specified in the PDB File

5gk3 5gk5 5gk6 5gk7 5gk8