Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN GLUTATHIONE TRANSFERASE PI COMPLEXED WITH A METALLOID IN THE PRESENCE OF GLUTATHIONE
 
Authors :  L. J. Parker, M. W. Parker, C. J. Morton
Date :  20 Aug 15  (Deposition) - 07 Dec 16  (Release) - 07 Dec 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Transferase, Metalloid, Anti-Cancer (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. J. Parker, M. W. Parker, C. J. Morton, A. Bocedi, D. B. Ascher, J. B. Aitken, H. H. Harris, M. Lo Bello, G. Ricci
Visualisation Of Organoarsenic Human Glutathione Transferas P1-1 Complexes: Metabolism Of Arsenic-Based Therapeutics
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - GLUTATHIONE S-TRANSFERASE P
    ChainsA
    EC Number2.5.1.18
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneGSTP1, FAEES3, GST3
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymGST CLASS-PI,GSTP1-1
 
Molecule 2 - GLUTATHIONE S-TRANSFERASE P
    ChainsB
    EC Number2.5.1.18
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneGSTP1, FAEES3, GST3
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymGST CLASS-PI,GSTP1-1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (6, 10)

Asymmetric/Biological Unit (6, 10)
No.NameCountTypeFull Name
15AU2Ligand/IonDI-GLUTATHIONE-PHENYLARSINE
2CSO1Mod. Amino AcidS-HYDROXYCYSTEINE
3GSH2Ligand/IonGLUTATHIONE
4MES2Ligand/Ion2-(N-MORPHOLINO)-ETHANESULFONIC ACID
5PA02Ligand/IonPHENYLARSINE OXIDE
6SO41Ligand/IonSULFATE ION

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREALA A:22 , TRP A:28 , GLU A:197 , HOH A:401 , HOH A:457binding site for residue MES A 301
2AC2SOFTWARETYR A:7 , PHE A:8 , VAL A:10 , ARG A:13 , TRP A:38 , LYS A:44 , GLN A:51 , LEU A:52 , PRO A:53 , GLN A:64 , SER A:65 , ILE A:104 , TYR A:108 , GSH A:303 , PA0 A:304 , HOH A:412 , HOH A:415 , HOH A:460 , HOH A:469 , HOH A:481 , HOH A:509 , HOH A:527 , ASP B:98binding site for residue 5AU A 302
3AC3SOFTWAREPHE A:8 , ARG A:13 , TRP A:38 , LYS A:44 , GLN A:51 , LEU A:52 , PRO A:53 , GLN A:64 , SER A:65 , 5AU A:302 , HOH A:469 , HOH A:481 , ASP B:98binding site for residue GSH A 303
4AC4SOFTWARECYS A:101 , 5AU A:302binding site for residue PA0 A 304
5AC5SOFTWAREHOH A:402 , ALA B:22 , TRP B:28 , GLU B:197 , SO4 B:302 , HOH B:476binding site for residue MES B 301
6AC6SOFTWARESER B:27 , TRP B:28 , MES B:301binding site for residue SO4 B 302
7AC7SOFTWAREASP A:98 , TYR B:7 , PHE B:8 , VAL B:10 , ARG B:13 , TRP B:38 , LYS B:44 , GLN B:51 , LEU B:52 , PRO B:53 , GLN B:64 , SER B:65 , ILE B:104 , TYR B:108 , GLY B:205 , GSH B:304 , PA0 B:305 , HOH B:420 , HOH B:421 , HOH B:455 , HOH B:485 , HOH B:504binding site for residue 5AU B 303
8AC8SOFTWAREASP A:98 , ARG B:13 , TRP B:38 , LYS B:44 , GLY B:50 , GLN B:51 , LEU B:52 , PRO B:53 , GLN B:64 , SER B:65 , 5AU B:303 , HOH B:421 , HOH B:485 , HOH B:504 , HOH B:548binding site for residue GSH B 304
9AC9SOFTWARECYS B:101 , 5AU B:303binding site for residue PA0 B 305

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5DAL)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1Leu A:52 -Pro A:53
2Pro B:1 -Pro B:2
3Leu B:52 -Pro B:53

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5DAL)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5DAL)

(-) Exons   (0, 0)

(no "Exon" information available for 5DAL)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee...hhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5dal A   0 MPPYTVVYFPVRGRcAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ 209
                                     9    |   19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209
                                         14-CSO                                                                                                                                                                                               

Chain B from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...hhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5dal B   1 PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ 209
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5DAL)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5DAL)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5DAL)

(-) Gene Ontology  (63, 63)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5AU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CSO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GSH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PA0  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:52 - Pro A:53   [ RasMol ]  
    Leu B:52 - Pro B:53   [ RasMol ]  
    Pro B:1 - Pro B:2   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5dal
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GSTP1_HUMAN | P09211
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.18
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GSTP1_HUMAN | P09211
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GSTP1_HUMAN | P0921110gs 11gs 12gs 13gs 14gs 16gs 17gs 18gs 19gs 1aqv 1aqw 1aqx 1eog 1eoh 1gss 1kbn 1lbk 1md3 1md4 1pgt 1px6 1px7 1zgn 20gs 22gs 2a2r 2a2s 2gss 2j9h 2pgt 3csh 3csi 3csj 3dd3 3dgq 3gss 3gus 3hjm 3hjo 3hkr 3ie3 3km6 3kmn 3kmo 3n9j 3pgt 4gss 4pgt 5dak 5dcg 5ddl 5djl 5djm 5gss 5j41 5jcw 5l6x 6gss 7gss 8gss 9gss

(-) Related Entries Specified in the PDB File

5dak 5dcg 5ddl