Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HGSTP1-1 WITH GLUTATHIONE ADDUCT OF PHENETHYL ISOTHIOCYANATE
 
Authors :  V. Kumari, X. Ji
Date :  15 Apr 16  (Deposition) - 12 Oct 16  (Release) - 12 Oct 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.95
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Gst, Peitc, Glutathione Adduct, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  V. Kumari, M. A. Dyba, R. J. Holland, Y. H. Liang, S. V. Singh, X. Ji
Irreversible Inhibition Of Glutathione S-Transferase By Phenethyl Isothiocyanate (Peitc), A Dietary Cancer Chemopreventive Phytochemical.
Plos One V. 11 63821 2016
PubMed-ID: 27684484  |  Reference-DOI: 10.1371/JOURNAL.PONE.0163821
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GLUTATHIONE S-TRANSFERASE P
    Chains: A, B
    EC Number: 2.5.1.18
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET9A
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: GSTP1, FAEES3, GST3
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: GST CLASS-PI,GSTP1-1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 15)

Asymmetric/Biological Unit (5, 15)
No.NameCountTypeFull Name
1ACT2Ligand/IonACETATE ION
2CA8Ligand/IonCALCIUM ION
3GSH1Ligand/IonGLUTATHIONE
4GVX2Ligand/IonL-GAMMA-GLUTAMYL-S-[(2-PHENYLETHYL)CARBAMOTHIOYL]-L-CYSTEINYLGLYCINE
5MPD2Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL

(-) Sites  (15, 15)

Asymmetric Unit (15, 15)
No.NameEvidenceResiduesDescription
01AC1SOFTWARETYR A:7 , PHE A:8 , ARG A:13 , TRP A:38 , LYS A:44 , GLN A:51 , LEU A:52 , PRO A:53 , GLN A:64 , SER A:65 , ILE A:104 , TYR A:108 , MPD A:302 , HOH A:431 , HOH A:477 , HOH A:483 , HOH A:491 , ASP B:98binding site for residue GVX A 301
02AC2SOFTWAREPHE A:8 , GVX A:301binding site for residue MPD A 302
03AC3SOFTWAREGLN A:147 , ILE A:148 , ARG A:186 , HOH A:478binding site for residue ACT A 303
04AC4SOFTWARETRP A:28 , HOH A:458 , HOH A:538 , HOH A:546 , HOH A:564 , HOH A:592 , ASP B:171 , HOH B:591binding site for residue CA A 304
05AC5SOFTWAREGLY A:77 , GLN A:147 , HOH A:470 , HOH A:531 , HOH A:549 , HOH A:556 , HOH A:575binding site for residue CA A 305
06AC6SOFTWAREASP A:171 , HOH A:401 , HOH A:479 , HOH A:573 , GLU B:30 , HOH B:513 , HOH B:582binding site for residue CA A 306
07AC7SOFTWAREALA A:113 , ASP A:116 , ASP A:117 , HOH A:405 , HOH A:553binding site for residue CA A 307
08AC8SOFTWAREARG A:74 , TYR A:79 , GLY A:80 , ASP A:82 , GLN A:83 , ARG B:74 , TYR B:79 , ALA B:86binding site for residue GSH A 308
09AC9SOFTWAREASP A:98 , TYR B:7 , PHE B:8 , ARG B:13 , TRP B:38 , LYS B:44 , GLN B:51 , LEU B:52 , GLN B:64 , SER B:65 , TYR B:108 , MPD B:302 , HOH B:412 , HOH B:431 , HOH B:498 , HOH B:503 , HOH B:504 , HOH B:557binding site for residue GVX B 301
10AD1SOFTWAREPHE B:8 , TYR B:108 , GVX B:301binding site for residue MPD B 302
11AD2SOFTWAREPHE B:142 , GLN B:147 , ILE B:148 , ARG B:186 , HOH B:500binding site for residue ACT B 303
12AD3SOFTWAREASP A:171 , TRP B:28 , HOH B:477 , HOH B:560 , HOH B:567 , HOH B:572 , HOH B:585binding site for residue CA B 304
13AD4SOFTWAREGLY B:77 , GLN B:147 , HOH B:489 , HOH B:523 , HOH B:528 , HOH B:539 , HOH B:587binding site for residue CA B 305
14AD5SOFTWAREGLU A:30 , HOH A:570 , HOH A:576 , ASP B:171 , HOH B:512 , HOH B:546 , HOH B:568binding site for residue CA B 306
15AD6SOFTWAREALA B:113 , ASP B:116 , HOH B:404 , HOH B:457 , HOH B:564 , HOH B:566binding site for residue CA B 307

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5JCW)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Leu A:52 -Pro A:53
2Leu B:52 -Pro B:53

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5JCW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5JCW)

(-) Exons   (0, 0)

(no "Exon" information available for 5JCW)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...hhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jcw A   1 PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ 209
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200         


Chain B from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...hhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jcw B   1 PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ 209
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5JCW)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5JCW)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5JCW)

(-) Gene Ontology  (63, 63)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GSH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GVX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MPD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:52 - Pro A:53   [ RasMol ]  
    Leu B:52 - Pro B:53   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5jcw
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GSTP1_HUMAN | P09211
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.18
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GSTP1_HUMAN | P09211
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GSTP1_HUMAN | P09211: 10gs 11gs 12gs 13gs 14gs 16gs 17gs 18gs 19gs 1aqv 1aqw 1aqx 1eog 1eoh 1gss 1kbn 1lbk 1md3 1md4 1pgt 1px6 1px7 1zgn 20gs 22gs 2a2r 2a2s 2gss 2j9h 2pgt 3csh 3csi 3csj 3dd3 3dgq 3gss 3gus 3hjm 3hjo 3hkr 3ie3 3km6 3kmn 3kmo 3n9j 3pgt 4gss 4pgt 5dak 5dal 5dcg 5ddl 5djl 5djm 5gss 5j41 5l6x 6gss 7gss 8gss 9gss

(-) Related Entries Specified in the PDB File

5jcu