4WZV - JenaLib

Title :   CRYSTAL STRUCTURE OF A HYDROXAMATE BASED INHIBITOR EN140 IN COMPLEX WITH THE MMP-9 CATALYTIC DOMAIN

Authors :   E. A. Stura, L. Vera, E. Cassar-Lajeunesse, E. Nuti, V. Dive, A. Rossell

Date :   20 Nov 14 (Deposition) - 26 Aug 15 (Release) - 07 Oct 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.65

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Mmp9 Inhibitor Complex, Thyroid Hormone-Binding Protein, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   E. Nuti, A. R. Cantelmo, C. Gallo, A. Bruno, B. Bassani, C. Camodeca, T. Tuccinardi, L. Vera, E. Orlandini, S. Nencetti, E. A. Stura, A. Martinelli, V. Dive, A. Albini, A. Rossello
N-O-Isopropyl Sulfonamido-Based Hydroxamates As Matrix Metalloproteinase Inhibitors: Hit Selection And In Vivo Antiangiogenic Activity.
J. Med. Chem. V. 58 7224 2015
PubMed-ID: 26263024 | Reference-DOI: 10.1021/ACS.JMEDCHEM.5B00367

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (9, 29)

Asymmetric Unit (9, 29)

No.	Name	Count	Type	Full Name
1	AZI	1	Ligand/Ion	AZIDE ION
2	CA	6	Ligand/Ion	CALCIUM ION
3	E40	2	Ligand/Ion	(2R)-4-(1,3-DIOXO-1,3-DIHYDRO-2H-ISOINDOL-2-YL)-N-HYDROXY-2-{[(4'-METHOXYBIPHENYL-4-YL)SULFONYL](PROPAN-2-YLOXY)AMINO}BUTANAMIDE
4	EDO	2	Ligand/Ion	1,2-ETHANEDIOL
5	GOL	1	Ligand/Ion	GLYCEROL
6	NA	7	Ligand/Ion	SODIUM ION
7	PEG	4	Ligand/Ion	DI(HYDROXYETHYL)ETHER
8	PGO	2	Ligand/Ion	S-1,2-PROPANEDIOL
9	ZN	4	Ligand/Ion	ZINC ION

Biological Unit 1 (4, 6)

No.	Name	Count	Type	Full Name
1	AZI	-1	Ligand/Ion	AZIDE ION
2	CA	-1	Ligand/Ion	CALCIUM ION
3	E40	1	Ligand/Ion	(2R)-4-(1,3-DIOXO-1,3-DIHYDRO-2H-ISOINDOL-2-YL)-N-HYDROXY-2-{[(4'-METHOXYBIPHENYL-4-YL)SULFONYL](PROPAN-2-YLOXY)AMINO}BUTANAMIDE
4	EDO	1	Ligand/Ion	1,2-ETHANEDIOL
5	GOL	-1	Ligand/Ion	GLYCEROL
6	NA	-1	Ligand/Ion	SODIUM ION
7	PEG	2	Ligand/Ion	DI(HYDROXYETHYL)ETHER
8	PGO	2	Ligand/Ion	S-1,2-PROPANEDIOL
9	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 2 (5, 6)

No.	Name	Count	Type	Full Name
1	AZI	1	Ligand/Ion	AZIDE ION
2	CA	-1	Ligand/Ion	CALCIUM ION
3	E40	1	Ligand/Ion	(2R)-4-(1,3-DIOXO-1,3-DIHYDRO-2H-ISOINDOL-2-YL)-N-HYDROXY-2-{[(4'-METHOXYBIPHENYL-4-YL)SULFONYL](PROPAN-2-YLOXY)AMINO}BUTANAMIDE
4	EDO	1	Ligand/Ion	1,2-ETHANEDIOL
5	GOL	1	Ligand/Ion	GLYCEROL
6	NA	-1	Ligand/Ion	SODIUM ION
7	PEG	2	Ligand/Ion	DI(HYDROXYETHYL)ETHER
8	PGO	-1	Ligand/Ion	S-1,2-PROPANEDIOL
9	ZN	-1	Ligand/Ion	ZINC ION

Sites (28, 28)

Asymmetric Unit (28, 28)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	LEU A:187 , LEU A:188 , ALA A:189 , HIS A:190 , ALA A:191 , HIS A:226 , GLU A:227 , HIS A:230 , ASP A:235 , HIS A:236 , LEU A:243 , TYR A:245 , PRO A:246 , MET A:247 , TYR A:248 , ZN A:302 , PGO A:308 , TYR B:245 , PRO B:246 , MET B:247	binding site for residue E40 A 301
02	AC2	SOFTWARE	HIS A:226 , HIS A:230 , HIS A:236 , E40 A:301	binding site for residue ZN A 302
03	AC3	SOFTWARE	HIS A:175 , ASP A:177 , HIS A:190 , HIS A:203	binding site for residue ZN A 303
04	AC4	SOFTWARE	ASP A:165 , GLY A:197 , GLN A:199 , ASP A:201 , HOH A:699 , HOH A:703	binding site for residue CA A 304
05	AC5	SOFTWARE	ASP A:131 , ASP A:206 , GLU A:208 , HOH A:804	binding site for residue CA A 305
06	AC6	SOFTWARE	ASP A:182 , GLY A:183 , ASP A:185 , LEU A:187 , ASP A:205 , GLU A:208	binding site for residue CA A 306
07	AC7	SOFTWARE	VAL A:172 , ASP A:206 , ASP A:207	binding site for residue EDO A 307
08	AC8	SOFTWARE	ARG A:249 , THR A:251 , E40 A:301	binding site for residue PGO A 308
09	AC9	SOFTWARE	ASP A:207 , HOH A:796 , HOH A:884	binding site for residue PGO A 309
10	AD1	SOFTWARE	HOH A:632 , HOH A:803	binding site for residue PEG A 310
11	AD2	SOFTWARE	VAL A:172 , HOH A:645 , HOH A:651	binding site for residue PEG A 311
12	AD3	SOFTWARE	TYR A:245 , PRO A:246 , MET A:247 , LEU B:187 , LEU B:188 , ALA B:189 , HIS B:190 , ALA B:191 , LEU B:222 , HIS B:226 , GLU B:227 , HIS B:230 , ASP B:235 , HIS B:236 , LEU B:243 , TYR B:245 , PRO B:246 , MET B:247 , ZN B:302 , HOH B:915	binding site for residue E40 B 301
13	AD4	SOFTWARE	HIS B:226 , HIS B:230 , HIS B:236 , E40 B:301	binding site for residue ZN B 302
14	AD5	SOFTWARE	HIS B:175 , ASP B:177 , HIS B:190 , HIS B:203	binding site for residue ZN B 303
15	AD6	SOFTWARE	ASP B:165 , GLY B:197 , GLN B:199 , ASP B:201 , HOH B:740 , HOH B:742	binding site for residue CA B 304
16	AD7	SOFTWARE	ASP B:131 , ASP B:206 , GLU B:208 , HOH B:656	binding site for residue CA B 305
17	AD8	SOFTWARE	ASP B:182 , GLY B:183 , ASP B:185 , LEU B:187 , ASP B:205 , GLU B:208	binding site for residue CA B 306
18	AD9	SOFTWARE	TYR B:160 , HOH B:627 , HOH B:640	binding site for residue EDO B 307
19	AE1	SOFTWARE	HOH B:644	binding site for residue AZI B 308
20	AE2	SOFTWARE	PEG B:317 , HOH B:709	binding site for residue NA B 310
21	AE3	SOFTWARE	HOH A:786 , HOH A:841 , HOH B:856 , HOH B:859	binding site for residue NA B 311
22	AE4	SOFTWARE	ARG B:158 , HOH B:744 , HOH B:766 , HOH B:839	binding site for residue NA B 312
23	AE5	SOFTWARE	SER B:238 , HOH B:835	binding site for residue NA B 313
24	AE6	SOFTWARE	LYS B:184 , GLY B:217 , GLY B:269 , HOH B:626 , HOH B:660 , HOH B:680	binding site for residue NA B 314
25	AE7	SOFTWARE	HOH A:730 , HOH A:813 , HOH B:753	binding site for residue NA B 315
26	AE8	SOFTWARE	ALA A:146 , SER A:149 , GLU B:241 , PRO B:254 , LEU B:256 , HIS B:257 , HOH B:601 , HOH B:611 , HOH B:857	binding site for residue GOL B 316
27	AE9	SOFTWARE	NA B:310 , HOH B:613 , HOH B:653 , HOH B:766	binding site for residue PEG B 317
28	AF1	SOFTWARE	HOH B:794 , HOH B:806	binding site for residue PEG B 318

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:158
                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeee.......hhhhhhhhhhhhhhhhhh....eeee.......eeeeee.................eee..........eeee....ee......eehhhhhhhhhhhhh........................hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wzv A 112 GDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG 269
                                   121       131       141       151       161       171       181       191       201       211       221       231       241       251       261

Chain B from PDB  Type:PROTEIN  Length:158
                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeee.......hhhhhhhhhhhhhhhhhhh...eeee.......eeeeee.................eee..........eeee....ee......eehhhhhhhhhhhhh........................hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wzv B 112 GDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG 269
                                   121       131       141       151       161       171       181       191       201       211       221       231       241       251       261

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (38, 38)

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		AZI	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		E40	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PEG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PGO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]
		AD6	[ RasMol ]	+environment [ RasMol ]
		AD7	[ RasMol ]	+environment [ RasMol ]
		AD8	[ RasMol ]	+environment [ RasMol ]
		AD9	[ RasMol ]	+environment [ RasMol ]
		AE1	[ RasMol ]	+environment [ RasMol ]
		AE2	[ RasMol ]	+environment [ RasMol ]
		AE3	[ RasMol ]	+environment [ RasMol ]
		AE4	[ RasMol ]	+environment [ RasMol ]
		AE5	[ RasMol ]	+environment [ RasMol ]
		AE6	[ RasMol ]	+environment [ RasMol ]
		AE7	[ RasMol ]	+environment [ RasMol ]
		AE8	[ RasMol ]	+environment [ RasMol ]
		AE9	[ RasMol ]	+environment [ RasMol ]
		AF1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4wzv)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	4wzv
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MMP9_HUMAN \| P14780
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.24.35
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description