Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  A SINGLE DIASTEREOMER OF A MACROLACTAM CORE BINDS SPECIFICALLY TO MYELOID CELL LEUKEMIA 1 (MCL1)
 
Authors :  M. C. Clifton, J. W. Fairman, C. Fang, B. D'Souza, B. Fulroth, A. Leed, P. L. Wang, Y. Wang, V. Kaushik, M. Palmer, G. Wei, T. R. Golub, B. K. Hubbar M. H. Serrano-Wu
Date :  18 Sep 14  (Deposition) - 19 Nov 14  (Release) - 31 Dec 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.85
Chains :  Asym./Biol. Unit :  A
Keywords :  Fusion Protein, Mbp, Transport Protein, Transport Protein-Inhibitor Complex, Apoptosis-Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Fang, B. D'Souza, C. F. Thompson, M. C. Clifton, J. W. Fairman, B. Fulroth, A. Leed, P. Mccarren, L. Wang, Y. Wang, C. Feau, V. K. Kaushik, M. Palmer, G. Wei, T. R. Golub, B. K. Hubbard, M. H. Serrano-Wu
Single Diastereomer Of A Macrolactam Core Binds Specificall To Myeloid Cell Leukemia 1 (Mcl1).
Acs Med. Chem. Lett. V. 5 1308 2014
PubMed-ID: 25516789  |  Reference-DOI: 10.1021/ML500388Q

(-) Compounds

Molecule 1 - MALTOSE-BINDING PERIPLASMIC PROTEIN,INDUCED MYELOID LEUKEMIA CELL DIFFERENTIATION PROTEIN MCL-1
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 27-392,UNP RESIDUES 173-291
    Gene: MALE, Z5632, ECS5017, MCL1, BCL2L3
    Mutation: YES
    Organism Common: HUMAN
    Organism Taxid: 83334, 9606
    Synonym: MBP,MMBP,MALTODEXTRIN-BINDING PROTEIN,BCL-2-LIKE PROTEIN 3, BCL2-L-3,BCL-2-RELATED PROTEIN EAT/MCL1,MCL1/EAT

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 13)

Asymmetric/Biological Unit (4, 13)
No.NameCountTypeFull Name
13M61Ligand/Ion(2S)-2-[(2S,3R)-10-{[(4-FLUOROPHENYL)SULFONYL]AMINO}-3-METHYL-2-[(METHYL{[4-(TRIFLUOROMETHYL)PHENYL]CARBAMOYL}AMINO)METHYL]-6-OXO-3,4-DIHYDRO-2H-1,5-BENZOXAZOCIN-5(6H)-YL]PROPANOIC ACID
2FMT10Ligand/IonFORMIC ACID
3MAL1Ligand/IonMALTOSE
4MG1Ligand/IonMAGNESIUM ION

(-) Sites  (13, 13)

Asymmetric Unit (13, 13)
No.NameEvidenceResiduesDescription
01AC1SOFTWARETYR A:-41 , ASP A:-131 , TRP A:-134 , GLU A:-43 , PRO A:-42 , ALA A:-133 , ARG A:-130 , GLU A:-85 , ASP A:-182 , LYS A:-181 , TRP A:34 , TRP A:144 , ARG A:148 , HOH A:659 , HOH A:697 , HOH A:732 , HOH A:824 , HOH A:826 , HOH A:827 , HOH A:829binding site for residue MAL A 401
02AC2SOFTWAREALA A:227 , PHE A:228 , MET A:231 , PHE A:254 , THR A:259 , ARG A:263 , ILE A:264 , THR A:266 , LEU A:267 , PHE A:270 , LYS A:302 , HOH A:763 , HOH A:935binding site for residue 3M6 A 402
03AC3SOFTWAREASP A:167 , FMT A:411 , HOH A:539 , HOH A:548 , HOH A:555 , HOH A:557binding site for residue MG A 403
04AC4SOFTWAREASN A:-178 , LYS A:-181 , TYR A:-179 , ASP A:100 , LYS A:101 , HOH A:838binding site for residue FMT A 404
05AC5SOFTWAREMET A:134 , ASN A:136 , HOH A:859 , HOH A:864binding site for residue FMT A 405
06AC6SOFTWAREPRO A:-105 , LYS A:109 , HOH A:507 , HOH A:588 , HOH A:650binding site for residue FMT A 406
07AC7SOFTWAREPRO A:138 , TYR A:175 , HOH A:786binding site for residue FMT A 407
08AC8SOFTWAREPHE A:-2 , ASP A:1 , HOH A:899 , HOH A:917binding site for residue FMT A 408
09AC9SOFTWARELYS A:4 , ALA A:155 , GLY A:157binding site for residue FMT A 409
10AD1SOFTWAREALA A:105 , VAL A:106 , GLU A:112binding site for residue FMT A 410
11AD2SOFTWARELYS A:166 , ASP A:167 , THR A:170 , ARG A:310 , MG A:403 , HOH A:539 , HOH A:557binding site for residue FMT A 411
12AD3SOFTWAREARG A:263 , HOH A:583binding site for residue FMT A 412
13AD4SOFTWARETHR A:301 , LYS A:302 , ARG A:303 , ASP A:304 , HOH A:716binding site for residue FMT A 413

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4WGI)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Ala A:201 -Gly A:203
2Gly A:257 -Val A:258

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4WGI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4WGI)

(-) Exons   (0, 0)

(no "Exon" information available for 4WGI)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:513
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeee.....hhhhhhhhhhhhhhhhh..eeee...hhhhhhhhhhh......eeeee..hhhhhhhh........hhhhhh..hhhhhhhhee..ee..eeeeee..eeeee.........hhhhhhhhhhhhhh...eee.....hhhhhhhhhhhh..eee.......ee..hhhhhhhhhhhhhhhhh.......hhhhhhhhhhh..eeeeeehhhhhhhhhhhh..eeee............eeeeeeeee.....hhhhhhhhhhhh..hhhhhhhhhh.....ee.hhhhhhhhh.hhhhhhhhhhhhhhee.....hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4wgi A -196 GKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYEDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTGSELYRQSLEIISRYLREQATGAADTAPMGAGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHV  321
                                  -187      -177      -167      -157      -147      -137      -127      -117      -107       -97       -87       -77       -67       -57       -47       -37       -27  ||   -13        -3         7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197   ||  208       218       228       238       248       258       268       278       288       298       308       318   
                                                                                                                                                                                                      -24|                                                                                                                                                                                                                         201|                                                                                                                      
                                                                                                                                                                                                       -19                                                                                                                                                                                                                          203
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4WGI)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4WGI)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4WGI)

(-) Gene Ontology  (38, 38)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    3M6  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FMT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:201 - Gly A:203   [ RasMol ]  
    Gly A:257 - Val A:258   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4wgi
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MALE_ECO57 | P0AEY0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  MCL1_HUMAN | Q07820
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MALE_ECO57 | P0AEY0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MCL1_HUMAN | Q07820
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MALE_ECO57 | P0AEY0: 1a7l 1anf 1dmb 1ez9 1ezo 1ezp 1fqa 1fqb 1fqc 1fqd 1hsj 1iud 1jvx 1jvy 1jw4 1jw5 1lax 1lls 1mdp 1mdq 1mg1 1mh3 1mh4 1mpb 1mpc 1mpd 1n3w 1n3x 1nl5 1nmu 1omp 1peb 1r6z 1svx 1t0k 1y4c 1ytv 1ziu 1zjl 1zkb 1zmg 2v93 3io4 3io6 3mbp 3osq 3osr 3vd8 4feb 4mbp 4my2 4wrn 4wth 4wvg 4wvh 4wvi 4wvj 4xa2 4xai 4xaj 4xhs 4ys9 5bmy 5c7r 5cl1 5dfm 5e24 5e7u 5edu 5fio 5ii4 5jj4 5jon 5jtq 5jtr 5k94 5ldf 5lof 5t03 5t05 5t0a 5ttd
        MCL1_HUMAN | Q07820: 2kbw 2mhs 2nl9 2nla 2pqk 3d7v 3io9 3kj0 3kj1 3kj2 3kz0 3mk8 3pk1 3twu 3wix 3wiy 4bpi 4bpj 4hw2 4hw3 4hw4 4oq5 4oq6 4wmr 4wms 4wmt 4wmu 4wmv 4wmw 4wmx 4zbf 4zbi 5c3f 5c6h 5fc4 5fdo 5fdr 5iez 5if4 5jsb 5ku9 5lof 5mes 5mev 5uum 5vkc

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4WGI)