Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  FIMH LECTIN DOMAIN CO-CRYSTAL WITH A ALPHA-D-MANNOSIDE O-LINKED TO A PROPYNYL PARA METHOXY PHENYL
 
Authors :  J. Bouckaert, M. Touaibia, G. Roos, T. C. Shiao, Q. Wang, A. Papadopoulo
Date :  09 May 12  (Deposition) - 22 May 13  (Release) - 18 Jun 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.25
Chains :  Asym./Biol. Unit :  A
Keywords :  Sugar Binding Protein, Fimbriae, Variable Immunoglobulin Fold, Urinary Tract Infection (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. Roos, A. Wellens, M. Touaibia, N. Yamakawa, P. Geerlings, R. Roy, L. Wyns, J. Bouchaert
Validation Of Reactivity Descriptors To Assess The Aromatic Stacking Within The Tyrosine Gate Of Fimh.
Acs Med. Chem. Lett. V. 4 1085 2013
PubMed-ID: 24900609  |  Reference-DOI: 10.1021/ML400269V

(-) Compounds

Molecule 1 - FIMH
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Variant: C43
    Expression System Vector: PET24A
    Expression System Vector Type: PLASMID
    Fragment: LECTIN DOMAIN, RESIDUES 10-167
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 364106
    Other Details: RESIDUES 1-158 OF THE MATURE FIMH SEQUENCE
    Strain: UTI89

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1HNV1Ligand/Ion3-(4-METHOXYPHENYL)PROP-2-YN-1-YLALPHA-D-MANNOPYRANOSIDE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPHE A:1 , ILE A:13 , PRO A:26 , VAL A:27 , ASN A:46 , ASP A:47 , TYR A:48 , ILE A:52 , ASP A:54 , GLN A:133 , ASN A:135 , TYR A:137 , ASP A:140 , ASN A:152 , ASP A:153 , HOH A:2001BINDING SITE FOR RESIDUE HNV A 201

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:3 -A:44

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Phe A:84 -Pro A:85

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4ATT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4ATT)

(-) Exons   (0, 0)

(no "Exon" information available for 4ATT)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:158
 aligned with A2IC68_ECOLX | A2IC68 from UniProtKB/TrEMBL  Length:227

    Alignment length:158
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159        
         A2IC68_ECOLX    10 FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT 167
               SCOP domains d4atta_ A: Mannose-specific adhesin FimH                                                                                                                       SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee....ee....eeeeeee...........eeee....eeee........eeeeeeeeeehhhhhhheeeeeee..eeeee........eee.....ee..eeeeeee.....eeee....eeeeeeeeeee......eeeeeeeee...eee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4att A   1 FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT 158
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150        


Chain A from PDB  Type:PROTEIN  Length:158
 aligned with FIMH_ECOLI | P08191 from UniProtKB/Swiss-Prot  Length:300

    Alignment length:158
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171        
           FIMH_ECOLI    22 FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT 179
               SCOP domains d4atta_ A: Mannose-specific adhesin FimH                                                                                                                       SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee....ee....eeeeeee...........eeee....eeee........eeeeeeeeeehhhhhhheeeeeee..eeeee........eee.....ee..eeeeeee.....eeee....eeeeeeeeeee......eeeeeeeee...eee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4att A   1 FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT 158
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4ATT)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4ATT)

(-) Gene Ontology  (4, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (A2IC68_ECOLX | A2IC68)
biological process
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
cellular component
    GO:0009289    pilus    A proteinaceous hair-like appendage on the surface of bacteria ranging from 2-8 nm in diameter.

Chain A   (FIMH_ECOLI | P08191)
molecular function
    GO:0005537    mannose binding    Interacting selectively and non-covalently with mannose, a monosaccharide hexose, stereoisomeric with glucose, that occurs naturally only in polymerized forms called mannans.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
cellular component
    GO:0009289    pilus    A proteinaceous hair-like appendage on the surface of bacteria ranging from 2-8 nm in diameter.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HNV  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Phe A:84 - Pro A:85   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4att
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A2IC68_ECOLX | A2IC68
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  FIMH_ECOLI | P08191
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A2IC68_ECOLX | A2IC68
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FIMH_ECOLI | P08191
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        A2IC68_ECOLX | A2IC68: 4auj 4auu 4auy 4av0 4av4 4av5 4avh 4avi 4avj 4avk 5aap
        FIMH_ECOLI | P08191: 1kiu 1klf 1qun 1tr7 1uwf 1ze3 2vco 3rfz 3zl1 3zl2 4auj 4auu 4auy 4av0 4av4 4av5 4avh 4avi 4avj 4avk 4css 4cst 4j3o 4lov 4x50 4x5p 4x5q 4x5r 4xo8 4xo9 4xoa 4xob 4xod 5ab1 5abz 5cgb 5f2f 5f3f 5fx3 5jcq 5jcr 5l4t 5l4u 5l4v 5l4w 5l4x 5l4y 5mts
UniProtKB/TrEMBL
        A2IC68_ECOLX | A2IC68: 3zpd 4buq 4ca4 5fs5

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4ATT)