Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN TANKYRASE 2 IN COMPLEX WITH BSI-201.
 
Authors :  W. Qiu, R. Lam, V. Romanov, R. Gordon, S. Gebremeskel, J. Vodsedalek, C. I. Beletskaya, K. P. Battaile, E. F. Pai, N. Y. Chirgadze
Date :  26 May 14  (Deposition) - 15 Oct 14  (Release) - 07 Jan 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.15
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Poly(Adp-Ribosylation) Polymerase (Parp), Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  W. Qiu, R. Lam, O. Voytyuk, V. Romanov, R. Gordon, S. Gebremeskel, J. Vodsedalek, C. Thompson, I. Beletskaya, K. P. Battaile, E. F. Pai, R. Rottapel, N. Y. Chirgadze
Insights Into The Binding Of Parp Inhibitors To The Catalytic Domain Of Human Tankyrase-2.
Acta Crystallogr. , Sect. D V. 70 2740 2014
PubMed-ID: 25286857  |  Reference-DOI: 10.1107/S1399004714017660

(-) Compounds

Molecule 1 - TANKYRASE-2
    ChainsA, B, C, D
    EC Number2.4.2.30
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentPARP, CATALYTIC DOMAIN
    GeneTNKS2, PARP5B, TANK2, TNKL
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymTANK2,ADP-RIBOSYLTRANSFERASE DIPHTHERIA TOXIN-LIKE 6,ARTD6, POLY [ADP-RIBOSE] POLYMERASE 5B,TNKS-2,TRF1-INTERACTING ANKYRIN- RELATED ADP-RIBOSE POLYMERASE 2,TANKYRASE II,TANKYRASE-LIKE PROTEIN, TANKYRASE-RELATED PROTEIN

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 18)

Asymmetric Unit (3, 18)
No.NameCountTypeFull Name
133E10Ligand/Ion4-IODO-3-NITROBENZAMIDE
2IPA4Ligand/IonISOPROPYL ALCOHOL
3ZN4Ligand/IonZINC ION
Biological Unit 1 (2, 5)
No.NameCountTypeFull Name
133E3Ligand/Ion4-IODO-3-NITROBENZAMIDE
2IPA2Ligand/IonISOPROPYL ALCOHOL
3ZN-1Ligand/IonZINC ION
Biological Unit 2 (2, 3)
No.NameCountTypeFull Name
133E2Ligand/Ion4-IODO-3-NITROBENZAMIDE
2IPA1Ligand/IonISOPROPYL ALCOHOL
3ZN-1Ligand/IonZINC ION
Biological Unit 3 (2, 3)
No.NameCountTypeFull Name
133E2Ligand/Ion4-IODO-3-NITROBENZAMIDE
2IPA1Ligand/IonISOPROPYL ALCOHOL
3ZN-1Ligand/IonZINC ION
Biological Unit 4 (1, 3)
No.NameCountTypeFull Name
133E3Ligand/Ion4-IODO-3-NITROBENZAMIDE
2IPA-1Ligand/IonISOPROPYL ALCOHOL
3ZN-1Ligand/IonZINC ION

(-) Sites  (18, 18)

Asymmetric Unit (18, 18)
No.NameEvidenceResiduesDescription
01AC1SOFTWARECYS A:1081 , HIS A:1084 , CYS A:1089 , CYS A:1092binding site for residue ZN A 1201
02AC2SOFTWAREHIS A:1031 , GLY A:1032 , TYR A:1050 , TYR A:1060 , PHE A:1061 , SER A:1068 , TYR A:1071 , HOH A:1337 , HOH A:1384 , HOH A:1430binding site for residue 33E A 1202
03AC3SOFTWAREPHE A:1035 , ALA A:1038 , ILE A:1039 , GLY A:1043 , HIS A:1048 , IPA A:1205binding site for residue 33E A 1203
04AC4SOFTWARELYS A:999 , VAL A:1000 , CYS A:1001 , ASN A:1002 , LYS A:1003 , TRP A:1006 , TYR A:1148 , GLU A:1150binding site for residue 33E A 1204
05AC5SOFTWAREHIS A:1031 , ASP A:1045 , HIS A:1048 , ILE A:1059 , 33E A:1203binding site for residue IPA A 1205
06AC6SOFTWAREARG A:977 , GLU A:978 , HIS A:979 , GLY A:987 , PHE A:989 , HOH A:1403binding site for residue IPA A 1206
07AC7SOFTWARECYS B:1081 , HIS B:1084 , CYS B:1089 , CYS B:1092binding site for residue ZN B 1201
08AC8SOFTWAREPHE B:1035 , GLY B:1043 , HIS B:1048 , HOH B:1418binding site for residue 33E B 1202
09AC9SOFTWAREHIS B:1031 , GLY B:1032 , TYR B:1050 , TYR B:1060 , PHE B:1061 , ALA B:1062 , SER B:1068 , TYR B:1071 , HOH B:1338 , HOH B:1387binding site for residue 33E B 1203
10AD1SOFTWAREMET B:1054 , GLU B:1138 , HOH B:1351binding site for residue IPA B 1204
11AD2SOFTWARECYS C:1081 , HIS C:1084 , CYS C:1089 , CYS C:1092binding site for residue ZN C 1201
12AD3SOFTWAREHIS C:1031 , GLY C:1032 , TYR C:1050 , TYR C:1060 , PHE C:1061 , ALA C:1062 , SER C:1068 , TYR C:1071 , HOH C:1328 , HOH C:1371 , HOH C:1388binding site for residue 33E C 1202
13AD4SOFTWAREPHE C:1035 , ILE C:1039 , GLY C:1043 , HIS C:1048 , IPA C:1204binding site for residue 33E C 1203
14AD5SOFTWAREHIS C:1031 , ASP C:1045 , HIS C:1048 , 33E C:1203binding site for residue IPA C 1204
15AD6SOFTWARECYS D:1081 , HIS D:1084 , CYS D:1089 , CYS D:1092binding site for residue ZN D 1201
16AD7SOFTWAREHIS D:1031 , GLY D:1032 , TYR D:1060 , PHE D:1061 , ALA D:1062 , SER D:1068 , TYR D:1071 , GLU D:1138 , HOH D:1336 , HOH D:1405 , HOH D:1410binding site for residue 33E D 1202
17AD8SOFTWAREPHE D:1035 , ALA D:1038 , ILE D:1039 , GLY D:1043 , HIS D:1048 , HOH D:1354 , HOH D:1367 , HOH D:1386binding site for residue 33E D 1203
18AD9SOFTWAREVAL D:1000 , CYS D:1001 , ASN D:1002 , LYS D:1003 , TRP D:1006 , ARG D:1100 , TYR D:1148 , GLU D:1150binding site for residue 33E D 1204

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4TKI)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Asn A:1132 -Gly A:1133
2Gly C:1052 -Gly C:1053

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4TKI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4TKI)

(-) Exons   (0, 0)

(no "Exon" information available for 4TKI)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:199
                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhh...............eeeeeeeee..hhhhhhhhhhhhhhhhhh......eeeeee...hhhhhhhhh.hhhhh.........eee..hhhhhhh...hhhhh...............eeeeeeeee...eeee..............eeee..........eeee.hhh.eeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4tki A  962 DKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRP 1160
                                   971       981       991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151         

Chain B from PDB  Type:PROTEIN  Length:204
                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eee..hhhhhhhhhhhhh................eeeeeeeee.hhhhhhhhhhhhhhhhhh......eeeeee...hhhhhhhhh.hhhhh.........eee..hhhhhhhhh.hhhhh...............eeeeeeeee...eeee..............eeee..........eeee.hhh.eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                4tki B  954 LYFQGDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRP 1160
                                || 966       976       986       996      1006      1016      1026      1036      1046      1056      1066      1076      1086      1096      1106      1116      1126      1136      1146      1156    
                              958|                                                                                                                                                                                                      
                               962                                                                                                                                                                                                      

Chain C from PDB  Type:PROTEIN  Length:208
                                                                                                                                                                                                                                                 
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee....hhhhhhhhhhhhhh................eeeeeeeee.hhhhhhhhhhhhhhhhhhh.....eeeeee...hhhhhhhhh.hhhhh.........eee..hhhhhhh...hhhhh...............eeeeeeeee...eeee..............eeee..........eeee.hhh.eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4tki C  953 NLYFQGSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRP 1160
                                   962       972       982       992      1002      1012      1022      1032      1042      1052      1062      1072      1082      1092      1102      1112      1122      1132      1142      1152        

Chain D from PDB  Type:PROTEIN  Length:193
                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhh...............eeeeeeeee..hhhhhhhhhhhhhhhhhhh.....eeeeee...hhhhhhhhh.hhhhh.......eee..hhhhhhh...hhhhh...............eeeeeeeee...eeee..............eeee......eeee.hhh.eeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4tki D  962 DKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPLALAEYVIYRGEQAYPEYLITYQIMRP 1160
                                   971       981       991      1001      1011      1021      1031      1041      1053      1063      1073      1083      1093      1103      1113      1123     |1137      1147      1157   
                                                                                                                1049|                                                                         1129|                          
                                                                                                                 1052                                                                          1134                          

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4TKI)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4TKI)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4TKI)

(-) Gene Ontology  (29, 29)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    33E  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IPA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:1132 - Gly A:1133   [ RasMol ]  
    Gly C:1052 - Gly C:1053   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4tki
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TNKS2_HUMAN | Q9H2K2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.4.2.30
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TNKS2_HUMAN | Q9H2K2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TNKS2_HUMAN | Q9H2K22y0i 3kr7 3kr8 3mhj 3mhk 3p0n 3p0p 3p0q 3twq 3twr 3tws 3twt 3twu 3twv 3tww 3twx 3u9h 3u9y 3ua9 3w51 4avu 4avw 4bfp 4bj9 4bjb 4bjc 4bs4 4bu3 4bu5 4bu6 4bu7 4bu8 4bu9 4bua 4bud 4bue 4buf 4bui 4bus 4but 4buu 4buv 4buw 4bux 4buy 4hki 4hkk 4hkn 4hl5 4hlf 4hlg 4hlh 4hlk 4hlm 4hmh 4hyf 4iue 4j1z 4j21 4j22 4j3l 4j3m 4kzl 4kzq 4kzu 4l09 4l0b 4l0i 4l0s 4l0t 4l0v 4l10 4l2f 4l2g 4l2k 4l31 4l32 4l33 4l34 4m7b 4pml 4pnl 4pnm 4pnn 4pnq 4pnr 4pns 4pnt 4tju 4tjw 4tjy 4tk0 4tk5 4tkf 4tkg 4ufu 4ufy 4uhg 4ui3 4ui4 4ui5 4ui6 4ui7 4ui8 4uvl 4uvn 4uvo 4uvp 4uvs 4uvt 4uvu 4uvv 4uvw 4uvx 4uvy 4uvz 4ux4 4w5i 4z68 5adq 5adr 5ads 5adt 5aeh 5aku 5akw 5al1 5al2 5al3 5al4 5al5 5bxo 5bxu 5c5p 5c5q 5c5r 5dcz 5fpf 5fpg 5jrt

(-) Related Entries Specified in the PDB File

4pml 4pnl 4pnm 4pnn 4pnq 4pnr 4pns 4pnt 4tju 4tjw 4tjy 4tk0 4tk5 4tkf 4tkg