3TWR - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF ARC4 FROM HUMAN TANKYRASE 2 IN COMPLEX WITH PEPTIDE FROM HUMAN 3BP2

Authors :   S. Guettler, F. Sicheri

Date :   22 Sep 11 (Deposition) - 07 Dec 11 (Release) - 28 Dec 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.55

Chains :   Asym. Unit : A,B,C,D,E,F,G,H
Biol. Unit 1: A,E  (1x)
Biol. Unit 2: B,F  (1x)
Biol. Unit 3: C,G  (1x)
Biol. Unit 4: D,H  (1x)

Keywords :   Ankyrin Repeat, Protein-Protein Interaction, Substrate Recruitment, Poly(Adp-Ribosyl)Ation, Signaling Protein-Peptide Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Guettler, J. Larose, E. Petsalaki, G. Gish, A. Scotter, T. Pawson, R. Rottapel, F. Sicheri
Structural Basis And Sequence Rules For Substrate Recognition By Tankyrase Explain The Basis For Cherubism Disease.
Cell(Cambridge, Mass. ) V. 147 1340 2011
PubMed-ID: 22153077 | Reference-DOI: 10.1016/J.CELL.2011.10.046

Molecule 1 - TANKYRASE-2
	Chains	:	A, B, C, D
	EC Number	:	2.4.2.30
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PETM-30
	Expression System Strain	:	BL21-CODONPLUS(DE3)-RIL
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 484-649
	Gene	:	PARP5B, TANK2, TNKL, TNKS2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TANK2, POLY [ADP-RIBOSE] POLYMERASE 5B, TNKS-2, TRF1- INTERACTING ANKYRIN-RELATED ADP-RIBOSE POLYMERASE 2, TANKYRASE II, TANKYRASE-LIKE PROTEIN, TANKYRASE-RELATED PROTEIN

Molecule 2 - SH3 DOMAIN-BINDING PROTEIN 2
	Chains	:	E, F, G, H
	Engineered	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	SOLID-STATE SYNTHESIZED PEPTIDE
	Synonym	:	3BP-2
	Synthetic	:	YES

		1	2	3	4	5	6	7	8
Asymmetric Unit	:	A	B	C	D	E	F	G	H
Biological Unit 1 (1x)	:	A				E
Biological Unit 2 (1x)	:		B				F
Biological Unit 3 (1x)	:			C				G
Biological Unit 4 (1x)	:				D				H

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 15)

No.	Name	Count	Type	Full Name
1	PE8	2	Ligand/Ion	3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL
2	SET	4	Mod. Amino Acid	AMINOSERINE
3	SO4	9	Ligand/Ion	SULFATE ION

Biological Unit 1 (3, 4)

No.	Name	Count	Type	Full Name
1	PE8	1	Ligand/Ion	3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL
2	SET	1	Mod. Amino Acid	AMINOSERINE
3	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 2 (2, 3)

No.	Name	Count	Type	Full Name
1	PE8	-1	Ligand/Ion	3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL
2	SET	1	Mod. Amino Acid	AMINOSERINE
3	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 3 (3, 4)

No.	Name	Count	Type	Full Name
1	PE8	1	Ligand/Ion	3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL
2	SET	1	Mod. Amino Acid	AMINOSERINE
3	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 4 (2, 4)

No.	Name	Count	Type	Full Name
1	PE8	-1	Ligand/Ion	3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL
2	SET	1	Mod. Amino Acid	AMINOSERINE
3	SO4	3	Ligand/Ion	SULFATE ION

Asymmetric Unit (11, 11)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	LYS A:501 , TYR A:536 , HOH A:921 , LYS B:592 , ARG B:623 , GLN E:12	BINDING SITE FOR RESIDUE SO4 A 700
02	AC2	SOFTWARE	GLY A:503 , ARG A:538 , VAL A:539 , SER A:540 , VAL A:541 , HOH A:818 , HOH A:884 , ARG H:15	BINDING SITE FOR RESIDUE SO4 A 701
03	AC3	SOFTWARE	ARG B:494 , GLN B:495	BINDING SITE FOR RESIDUE SO4 B 700
04	AC4	SOFTWARE	TYR B:572 , GLU B:606 , TYR C:569 , GLY C:570 , GLY C:603 , LYS C:604 , SER G:13 , PHE G:14	BINDING SITE FOR RESIDUE PE8 C 700
05	AC5	SOFTWARE	HOH B:804 , ASN C:537 , GLY C:570 , HIS C:571 , TYR C:572 , GLU C:573 , HOH C:804 , HOH C:809 , HOH C:826 , ARG F:15 , HOH F:215	BINDING SITE FOR RESIDUE SO4 C 701
06	AC6	SOFTWARE	HOH B:924 , LYS C:592 , ARG C:623 , HOH C:899 , HOH C:939	BINDING SITE FOR RESIDUE SO4 C 702
07	AC7	SOFTWARE	ASN D:537 , GLY D:570 , HIS D:571 , TYR D:572 , GLU D:573 , HOH D:820 , HOH D:824 , HOH D:835 , HOH D:879 , HOH D:911 , ARG E:15	BINDING SITE FOR RESIDUE SO4 D 700
08	AC8	SOFTWARE	HOH A:818 , ASN D:537 , ARG D:538 , VAL D:539 , SER D:540 , HOH D:844 , HOH D:931 , HOH D:952 , ARG E:15	BINDING SITE FOR RESIDUE SO4 D 701
09	AC9	SOFTWARE	TYR A:569 , GLY A:570 , GLY A:603 , LYS A:604 , ASP B:624 , GLY B:625 , ASN B:626 , HOH B:974 , TYR D:572 , GLU D:576 , GLU D:606 , GLN D:613 , HIS D:614 , HOH D:824 , HOH D:901 , SER E:13 , PHE E:14	BINDING SITE FOR RESIDUE PE8 E 100
10	BC1	SOFTWARE	TYR B:569 , LYS B:602 , GLN F:12 , SER F:13	BINDING SITE FOR RESIDUE SO4 F 100
11	BC2	SOFTWARE	TYR D:569 , LYS D:602 , GLN H:12 , SER H:13	BINDING SITE FOR RESIDUE SO4 H 100

(no "SS Bond" information available for 3TWR)

(no "Cis Peptide Bond" information available for 3TWR)

Asymmetric Unit (7, 28)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_013257	R	415	P	3BP2_HUMAN	Disease (CRBM)	121909149	E/F/G/H	R	6	P
2	UniProt	VAR_013258	R	415	Q	3BP2_HUMAN	Disease (CRBM)	121909149	E/F/G/H	R	6	Q
3	UniProt	VAR_013259	P	418	H	3BP2_HUMAN	Disease (CRBM)	121909146	E/F/G/H	P	9	H
4	UniProt	VAR_013260	P	418	L	3BP2_HUMAN	Disease (CRBM)	121909146	E/F/G/H	P	9	L
5	UniProt	VAR_013261	P	418	R	3BP2_HUMAN	Disease (CRBM)	121909146	E/F/G/H	P	9	R
6	UniProt	VAR_013262	G	420	E	3BP2_HUMAN	Disease (CRBM)	28938171	E/F/G/H	G	11	E
7	UniProt	VAR_013263	G	420	R	3BP2_HUMAN	Disease (CRBM)	28938170	E/F/G/H	G	11	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (7, 7)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_013257	R	415	P	3BP2_HUMAN	Disease (CRBM)	121909149	E	R	6	P
2	UniProt	VAR_013258	R	415	Q	3BP2_HUMAN	Disease (CRBM)	121909149	E	R	6	Q
3	UniProt	VAR_013259	P	418	H	3BP2_HUMAN	Disease (CRBM)	121909146	E	P	9	H
4	UniProt	VAR_013260	P	418	L	3BP2_HUMAN	Disease (CRBM)	121909146	E	P	9	L
5	UniProt	VAR_013261	P	418	R	3BP2_HUMAN	Disease (CRBM)	121909146	E	P	9	R
6	UniProt	VAR_013262	G	420	E	3BP2_HUMAN	Disease (CRBM)	28938171	E	G	11	E
7	UniProt	VAR_013263	G	420	R	3BP2_HUMAN	Disease (CRBM)	28938170	E	G	11	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (7, 7)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_013257	R	415	P	3BP2_HUMAN	Disease (CRBM)	121909149	F	R	6	P
2	UniProt	VAR_013258	R	415	Q	3BP2_HUMAN	Disease (CRBM)	121909149	F	R	6	Q
3	UniProt	VAR_013259	P	418	H	3BP2_HUMAN	Disease (CRBM)	121909146	F	P	9	H
4	UniProt	VAR_013260	P	418	L	3BP2_HUMAN	Disease (CRBM)	121909146	F	P	9	L
5	UniProt	VAR_013261	P	418	R	3BP2_HUMAN	Disease (CRBM)	121909146	F	P	9	R
6	UniProt	VAR_013262	G	420	E	3BP2_HUMAN	Disease (CRBM)	28938171	F	G	11	E
7	UniProt	VAR_013263	G	420	R	3BP2_HUMAN	Disease (CRBM)	28938170	F	G	11	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (7, 7)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_013257	R	415	P	3BP2_HUMAN	Disease (CRBM)	121909149	G	R	6	P
2	UniProt	VAR_013258	R	415	Q	3BP2_HUMAN	Disease (CRBM)	121909149	G	R	6	Q
3	UniProt	VAR_013259	P	418	H	3BP2_HUMAN	Disease (CRBM)	121909146	G	P	9	H
4	UniProt	VAR_013260	P	418	L	3BP2_HUMAN	Disease (CRBM)	121909146	G	P	9	L
5	UniProt	VAR_013261	P	418	R	3BP2_HUMAN	Disease (CRBM)	121909146	G	P	9	R
6	UniProt	VAR_013262	G	420	E	3BP2_HUMAN	Disease (CRBM)	28938171	G	G	11	E
7	UniProt	VAR_013263	G	420	R	3BP2_HUMAN	Disease (CRBM)	28938170	G	G	11	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (7, 7)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_013257	R	415	P	3BP2_HUMAN	Disease (CRBM)	121909149	H	R	6	P
2	UniProt	VAR_013258	R	415	Q	3BP2_HUMAN	Disease (CRBM)	121909149	H	R	6	Q
3	UniProt	VAR_013259	P	418	H	3BP2_HUMAN	Disease (CRBM)	121909146	H	P	9	H
4	UniProt	VAR_013260	P	418	L	3BP2_HUMAN	Disease (CRBM)	121909146	H	P	9	L
5	UniProt	VAR_013261	P	418	R	3BP2_HUMAN	Disease (CRBM)	121909146	H	P	9	R
6	UniProt	VAR_013262	G	420	E	3BP2_HUMAN	Disease (CRBM)	28938171	H	G	11	E
7	UniProt	VAR_013263	G	420	R	3BP2_HUMAN	Disease (CRBM)	28938170	H	G	11	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 12)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ANK_REPEAT	PS50088	Ankyrin repeat profile.	TNKS2_HUMAN	57-89 90-122 123-155 210-242 243-275 276-308 363-398 399-431 432-464 525-557 558-590 591-623 678-710 711-743 744-776	12	- - - - - - - - - A:525-557 B:525-557 C:525-557 D:525-557 A:558-590 B:558-590 C:558-590 D:558-590 A:591-623 B:591-623 C:591-623 D:591-623 - - -

Biological Unit 1 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ANK_REPEAT	PS50088	Ankyrin repeat profile.	TNKS2_HUMAN	57-89 90-122 123-155 210-242 243-275 276-308 363-398 399-431 432-464 525-557 558-590 591-623 678-710 711-743 744-776	3	- - - - - - - - - A:525-557 - - - A:558-590 - - - A:591-623 - - - - - -

Biological Unit 2 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ANK_REPEAT	PS50088	Ankyrin repeat profile.	TNKS2_HUMAN	57-89 90-122 123-155 210-242 243-275 276-308 363-398 399-431 432-464 525-557 558-590 591-623 678-710 711-743 744-776	3	- - - - - - - - - - B:525-557 - - - B:558-590 - - - B:591-623 - - - - -

Biological Unit 3 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ANK_REPEAT	PS50088	Ankyrin repeat profile.	TNKS2_HUMAN	57-89 90-122 123-155 210-242 243-275 276-308 363-398 399-431 432-464 525-557 558-590 591-623 678-710 711-743 744-776	3	- - - - - - - - - - - C:525-557 - - - C:558-590 - - - C:591-623 - - - -

Biological Unit 4 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ANK_REPEAT	PS50088	Ankyrin repeat profile.	TNKS2_HUMAN	57-89 90-122 123-155 210-242 243-275 276-308 363-398 399-431 432-464 525-557 558-590 591-623 678-710 711-743 744-776	3	- - - - - - - - - - - - D:525-557 - - - D:558-590 - - - D:591-623 - - -

Asymmetric Unit (2, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.13b	ENST00000356331	13b	ENSE00001338971	chr4:2820541-2820797	257	3BP2_HUMAN	-	0	0	-	-
1.14a	ENST00000356331	14a	ENSE00002140445	chr4:2822341-2822480	140	3BP2_HUMAN	1-46	46	0	-	-
1.15	ENST00000356331	15	ENSE00000854861	chr4:2824662-2824764	103	3BP2_HUMAN	46-80	35	0	-	-
1.17b	ENST00000356331	17b	ENSE00001294178	chr4:2826340-2826457	118	3BP2_HUMAN	80-119	40	0	-	-
1.17k	ENST00000356331	17k	ENSE00002152783	chr4:2826853-2826923	71	3BP2_HUMAN	120-143	24	0	-	-
1.18f	ENST00000356331	18f	ENSE00002142654	chr4:2828957-2829045	89	3BP2_HUMAN	143-173	31	0	-	-
1.19c	ENST00000356331	19c	ENSE00000699174	chr4:2829333-2829401	69	3BP2_HUMAN	173-196	24	0	-	-
1.20c	ENST00000356331	20c	ENSE00001301413	chr4:2831220-2831874	655	3BP2_HUMAN	196-414	219	3	E:4-5 F:4-5 - H:5-5	2 2 - 1
1.21	ENST00000356331	21	ENSE00001507036	chr4:2833298-2833406	109	3BP2_HUMAN	414-450	37	4	E:5-16 F:5-16 G:6-16 H:5-16	12 12 11 12
1.22a	ENST00000356331	22a	ENSE00001507035	chr4:2833650-2833705	56	3BP2_HUMAN	451-469	19	0	-	-
1.22c	ENST00000356331	22c	ENSE00000854878	chr4:2834058-2834139	82	3BP2_HUMAN	469-496	28	0	-	-
1.23b	ENST00000356331	23b	ENSE00000699192	chr4:2834717-2834776	60	3BP2_HUMAN	497-516	20	0	-	-
1.23j	ENST00000356331	23j	ENSE00002020330	chr4:2835424-2842825	7402	3BP2_HUMAN	517-561	45	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:157
 aligned with TNKS2_HUMAN | Q9H2K2 from UniProtKB/Swiss-Prot  Length:1166

    Alignment length:157
                                   499       509       519       529       539       549       559       569       579       589       599       609       619       629       639       
          TNKS2_HUMAN   490 SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGD 646
               SCOP domains d3twra_ A: automated matches                                                                                                                                  SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhhh.............hhhhh...hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------ANK_REPEAT  PDB: A:525-557       ANK_REPEAT  PDB: A:558-590       ANK_REPEAT  PDB: A:591-623       ----------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3twr A 490 SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGD 646
                                   499       509       519       529       539       549       559       569       579       589       599       609       619       629       639

Chain B from PDB  Type:PROTEIN  Length:157
 aligned with TNKS2_HUMAN | Q9H2K2 from UniProtKB/Swiss-Prot  Length:1166

    Alignment length:157
                                   497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       
          TNKS2_HUMAN   488 GNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR 644
               SCOP domains d3twrb_ B: automated matches                                                                                                                                  SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhhh............hhhhhh...hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------ANK_REPEAT  PDB: B:525-557       ANK_REPEAT  PDB: B:558-590       ANK_REPEAT  PDB: B:591-623       --------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3twr B 488 GNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR 644
                                   497       507       517       527       537       547       557       567       577       587       597       607       617       627       637

Chain C from PDB  Type:PROTEIN  Length:158
 aligned with TNKS2_HUMAN | Q9H2K2 from UniProtKB/Swiss-Prot  Length:1166

    Alignment length:158
                                   497       507       517       527       537       547       557       567       577       587       597       607       617       627       637        
          TNKS2_HUMAN   488 GNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRG 645
               SCOP domains d3twrc_ C: automated matches                                                                                                                                   SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhhh............hhhhhh...hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------ANK_REPEAT  PDB: C:525-557       ANK_REPEAT  PDB: C:558-590       ANK_REPEAT  PDB: C:591-623       ---------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3twr C 488 GNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRG 645
                                   497       507       517       527       537       547       557       567       577       587       597       607       617       627       637

Chain D from PDB  Type:PROTEIN  Length:158
 aligned with TNKS2_HUMAN | Q9H2K2 from UniProtKB/Swiss-Prot  Length:1166

    Alignment length:158
                                   496       506       516       526       536       546       556       566       576       586       596       606       616       626       636        
          TNKS2_HUMAN   487 LGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR 644
               SCOP domains d3twrd_ D: automated matches                                                                                                                                   SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhhh.............hhhhh...hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------ANK_REPEAT  PDB: D:525-557       ANK_REPEAT  PDB: D:558-590       ANK_REPEAT  PDB: D:591-623       --------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3twr D 487 MGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR 644
                                   496       506       516       526       536       546       556       566       576       586       596       606       616       626       636

Chain E from PDB  Type:PROTEIN  Length:13
 aligned with 3BP2_HUMAN | P78314 from UniProtKB/Swiss-Prot  Length:561

    Alignment length:13
                                   422   
           3BP2_HUMAN   413 LQRSPPDGQSFRS 425
               SCOP domains ------------- SCOP domains
               CATH domains ------------- CATH domains
               Pfam domains ------------- Pfam domains
         Sec.struct. author ............. Sec.struct. author
             SAPs(SNPs) (1) --P--H-E----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --Q--L-R----- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----R------- SAPs(SNPs) (3)
                    PROSITE ------------- PROSITE
           Transcript 1 (1) 1.----------- Transcript 1 (1)
           Transcript 1 (2) -Exon 1.21    Transcript 1 (2)
                 3twr E   4 LQRSPPDGQSFRs  16
                                    13  |
                                       16-SET

Chain F from PDB  Type:PROTEIN  Length:13
 aligned with 3BP2_HUMAN | P78314 from UniProtKB/Swiss-Prot  Length:561

    Alignment length:13
                                   422   
           3BP2_HUMAN   413 LQRSPPDGQSFRS 425
               SCOP domains ------------- SCOP domains
               CATH domains ------------- CATH domains
               Pfam domains ------------- Pfam domains
         Sec.struct. author ............. Sec.struct. author
             SAPs(SNPs) (1) --P--H-E----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --Q--L-R----- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----R------- SAPs(SNPs) (3)
                    PROSITE ------------- PROSITE
           Transcript 1 (1) 1.----------- Transcript 1 (1)
           Transcript 1 (2) -Exon 1.21    Transcript 1 (2)
                 3twr F   4 LQRSPPDGQSFRs  16
                                    13  |
                                       16-SET

Chain G from PDB  Type:PROTEIN  Length:11
 aligned with 3BP2_HUMAN | P78314 from UniProtKB/Swiss-Prot  Length:561

    Alignment length:11
                                   424 
           3BP2_HUMAN   415 RSPPDGQSFRS 425
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author ........... Sec.struct. author
             SAPs(SNPs) (1) P--H-E----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) Q--L-R----- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---R------- SAPs(SNPs) (3)
                    PROSITE ----------- PROSITE
           Transcript 1 (1) ----------- Transcript 1 (1)
           Transcript 1 (2) Exon 1.21   Transcript 1 (2)
                 3twr G   6 RSPPDGQSFRs  16
                                    15|
                                     16-SET

Chain H from PDB  Type:PROTEIN  Length:12
 aligned with 3BP2_HUMAN | P78314 from UniProtKB/Swiss-Prot  Length:561

    Alignment length:12
                                   423  
           3BP2_HUMAN   414 QRSPPDGQSFRS 425
               SCOP domains ------------ SCOP domains
               CATH domains ------------ CATH domains
               Pfam domains ------------ Pfam domains
         Sec.struct. author ............ Sec.struct. author
             SAPs(SNPs) (1) -P--H-E----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -Q--L-R----- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ----R------- SAPs(SNPs) (3)
                    PROSITE ------------ PROSITE
           Transcript 1 (1) 1----------- Transcript 1 (1)
           Transcript 1 (2) Exon 1.21    Transcript 1 (2)
                 3twr H   5 QRSPPDGQSFRs  16
                                    14 |
                                      16-SET

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: beta-hairpin-alpha-hairpin repeat (81)

Superfamily: Ankyrin repeat (79)

Family: automated matches (19)

Protein domain: automated matches (19)

Human (Homo sapiens) [TaxId: 9606] (15)

1a	d3twra_	A:
1b	d3twrb_	B:
1c	d3twrc_	C:
1d	d3twrd_	D:

(no "CATH Domain" information available for 3TWR)

(no "Pfam Domain" information available for 3TWR)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (TNKS2_HUMAN | Q9H2K2)

molecular function
	GO:0003950	NAD+ ADP-ribosyltransferase activity	Catalysis of the reaction: NAD+ + (ADP-D-ribosyl)(n)-acceptor = nicotinamide + (ADP-D-ribosyl)(n+1)-acceptor.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016757	transferase activity, transferring glycosyl groups	Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor).
biological process
	GO:0016055	Wnt signaling pathway	The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
	GO:0035264	multicellular organism growth	The increase in size or mass of an entire multicellular organism, as opposed to cell growth.
	GO:1904357	negative regulation of telomere maintenance via telomere lengthening	Any process that stops, prevents or reduces the frequency, rate or extent of telomere maintenance via telomere lengthening.
	GO:0090263	positive regulation of canonical Wnt signaling pathway	Any process that increases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
	GO:1904355	positive regulation of telomere capping	Any process that activates or increases the frequency, rate or extent of telomere capping.
	GO:0032212	positive regulation of telomere maintenance via telomerase	Any process that activates or increases the frequency, rate or extent of the addition of telomeric repeats by telomerase.
	GO:0006471	protein ADP-ribosylation	The transfer, from NAD, of ADP-ribose to protein amino acids.
	GO:0070213	protein auto-ADP-ribosylation	The ADP-ribosylation by a protein of one or more of its own amino acid residues, or residues on an identical protein.
	GO:0070198	protein localization to chromosome, telomeric region	Any process in which a protein is transported to, or maintained at, the telomeric region of a chromosome.
	GO:0000209	protein polyubiquitination	Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
	GO:0040014	regulation of multicellular organism growth	Any process that modulates the frequency, rate or extent of growth of the body of an organism so that it reaches its usual body size.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0005694	chromosome	A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
	GO:0000781	chromosome, telomeric region	The terminal region of a linear chromosome that includes the telomeric DNA repeats and associated proteins.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0000784	nuclear chromosome, telomeric region	The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.
	GO:0005635	nuclear envelope	The double lipid bilayer enclosing the nucleus and separating its contents from the rest of the cytoplasm; includes the intermembrane space, a gap of width 20-40 nm (also called the perinuclear space).
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0000242	pericentriolar material	A network of small fibers that surrounds the centrioles in cells; contains the microtubule nucleating activity of the centrosome.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.

Chain E,F,G,H (3BP2_HUMAN | P78314)

molecular function
	GO:0017124	SH3 domain binding	Interacting selectively and non-covalently with a SH3 domain (Src homology 3) of a protein, small protein modules containing approximately 50 amino acid residues found in a great variety of intracellular or membrane-associated proteins.
	GO:0005070	SH3/SH2 adaptor activity	Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0009967	positive regulation of signal transduction	Any process that activates or increases the frequency, rate or extent of signal transduction.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		PE8	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SET	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3twr)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3twr
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	3BP2_HUMAN \| P78314
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TNKS2_HUMAN \| Q9H2K2
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.4.2.30
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	118400
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	3BP2_HUMAN \| P78314
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	TNKS2_HUMAN \| Q9H2K2
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 15)

Sites (11, 11)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (7, 28)

PROSITE Motifs (1, 12)

Exons (2, 7)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (33, 34)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File