Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE CK2 TETRAMERIC HOLOENZYME
 
Authors :  G. Lolli, R. Battistutta
Date :  26 Jan 12  (Deposition) - 02 May 12  (Release) - 02 Jan 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Protein Kinase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Lolli, L. A. Pinna, R. Battistutta
Structural Determinants Of Protein Kinase Ck2 Regulation By Autoinhibitory Polymerization.
Acs Chem. Biol. V. 7 1158 2012
PubMed-ID: 22506723  |  Reference-DOI: 10.1021/CB300054N

(-) Compounds

Molecule 1 - CASEIN KINASE II SUBUNIT BETA
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneCSNK2B, CK2N, G5A
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCK II BETA, PHOSVITIN, PROTEIN G5A
 
Molecule 2 - CASEIN KINASE II SUBUNIT ALPHA
    ChainsC, D
    EC Number2.7.11.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneCSNK2A1, CK2A1
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCK II ALPHA

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1ZN2Ligand/IonZINC ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:109 , CYS A:114 , CYS A:137 , CYS A:140BINDING SITE FOR RESIDUE ZN A 301
2AC2SOFTWARECYS B:109 , CYS B:114 , CYS B:137 , CYS B:140BINDING SITE FOR RESIDUE ZN B 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4DGL)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Glu C:230 -Pro C:231
2Glu D:230 -Pro D:231

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (4, 8)

Asymmetric/Biological Unit (4, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_077045R47QCSK21_HUMANDisease (OCNDS)869312845C/DR47Q
2UniProtVAR_077046Y50SCSK21_HUMANDisease (OCNDS)869312849C/DY50S
3UniProtVAR_077047D175GCSK21_HUMANDisease (OCNDS)869312848C/DD175G
4UniProtVAR_077048K198RCSK21_HUMANDisease (OCNDS)869312840C/DK198R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 6)

Asymmetric/Biological Unit (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.CSK21_HUMAN45-68
 
  2C:45-68
D:45-68
2CK2_BETAPS01101 Casein kinase II regulatory subunit signature.CSK2B_HUMAN109-140
 
  2A:109-140
B:109-140
3PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.CSK21_HUMAN152-164
 
  2C:152-164
D:152-164

(-) Exons   (17, 34)

Asymmetric/Biological Unit (17, 34)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000003497361bENSE00001937660chr20:524465-524316150CSK21_HUMAN-00--
1.3ENST000003497363ENSE00001709328chr20:489304-489095210CSK21_HUMAN1-34342C:2-34
D:3-34
33
32
1.4ENST000003497364ENSE00001688643chr20:485873-485762112CSK21_HUMAN34-71382C:34-71
D:34-71
38
38
1.5ENST000003497365ENSE00001705871chr20:480578-480477102CSK21_HUMAN72-105342C:72-105
D:72-105
34
34
1.6ENST000003497366ENSE00001598088chr20:479949-47989951CSK21_HUMAN106-122172C:106-122
D:106-122
17
17
1.7ENST000003497367ENSE00001618963chr20:478424-47836560CSK21_HUMAN123-142202C:123-142
D:123-142
20
20
1.8ENST000003497368ENSE00000655095chr20:476446-47636384CSK21_HUMAN143-170282C:143-170
D:143-170
28
28
1.9ENST000003497369ENSE00000655092chr20:473008-472898111CSK21_HUMAN171-207372C:171-207
D:171-207
37
37
1.10ENST0000034973610ENSE00001666435chr20:470525-470424102CSK21_HUMAN208-241342C:208-241
D:208-241
34
34
1.11bENST0000034973611bENSE00000655089chr20:469422-469322101CSK21_HUMAN242-275342C:242-275
D:242-275
34
34
1.12ENST0000034973612ENSE00000655088chr20:468219-468071149CSK21_HUMAN275-325512C:275-325
D:275-325
51
51
1.13ENST0000034973613ENSE00000655087chr20:467106-46702087CSK21_HUMAN325-354302C:325-335
D:325-330
11
6
1.14cENST0000034973614cENSE00001891680chr20:464720-4617412980CSK21_HUMAN354-391380--

2.12uENST0000040011012uENSE00001723915HSCHR6_MHC_QBL:31624378-31624510133CSK2B_HUMAN-00--
2.13ENST0000040011013ENSE00002150158HSCHR6_MHC_QBL:31624844-3162492683CSK2B_HUMAN1-24242A:8-24
B:7-24
17
18
2.15eENST0000040011015eENSE00001622533HSCHR6_MHC_QBL:31625891-31625993103CSK2B_HUMAN25-59352A:25-56
B:25-59
32
35
2.15jENST0000040011015jENSE00001756289HSCHR6_MHC_QBL:31626562-31626677116CSK2B_HUMAN59-97392A:65-97
B:59-97
33
39
2.15pENST0000040011015pENSE00002150315HSCHR6_MHC_QBL:31627120-3162719576CSK2B_HUMAN98-123262A:98-123
B:98-123
26
26
2.15rENST0000040011015rENSE00001673157HSCHR6_MHC_QBL:31627342-31627531190CSK2B_HUMAN123-186642A:123-186
B:123-186
64
64
2.15tENST0000040011015tENSE00001798282HSCHR6_MHC_QBL:31627859-31628093235CSK2B_HUMAN186-215302A:186-215
B:186-207
30
22

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:200
 aligned with CSK2B_HUMAN | P67870 from UniProtKB/Swiss-Prot  Length:215

    Alignment length:208
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207        
          CSK2B_HUMAN     8 SWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR 215
               SCOP domains d4dgla_ A: Casein kinase II beta subunit                                                                                                                                                                         SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhh..........hhhhhhh.....hhhhh..hhhhhhhhhh..--------..hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.......hhhhh....eeee.........eeee......ee..........hhhhh..hhhhhhhhhhhhhh..........ee..eee.hhhhhh.hhhhhh......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------CK2_BETA  PDB: A:109-140        --------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.13        Exon 2.15e  PDB: A:25-56           --------------------------------------Exon 2.15p  PDB: A:98-123 --------------------------------------------------------------Exon 2.15t  PDB: A:186-215     Transcript 2 (1)
           Transcript 2 (2) ---------------------------------------------------Exon 2.15j  PDB: A:65-97 UniProt: 59-97-------------------------Exon 2.15r  PDB: A:123-186 UniProt: 123-186                     ----------------------------- Transcript 2 (2)
                 4dgl A   8 SWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDL--------NPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR 215
                                    17        27        37        47        |-       |67        77        87        97       107       117       127       137       147       157       167       177       187       197       207        
                                                                           56       65                                                                                                                                                      

Chain B from PDB  Type:PROTEIN  Length:201
 aligned with CSK2B_HUMAN | P67870 from UniProtKB/Swiss-Prot  Length:215

    Alignment length:201
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206 
          CSK2B_HUMAN     7 VSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNF 207
               SCOP domains d4dglb_ B: Casein kinase II beta subunit                                                                                                                                                                  SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhh...........hhhhhhhhhhhhhhhhh..hhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh......hhhhh....eee...........eee......ee...hhhhh..hhhhh..hhhhhhhhhhhhhh..........ee..eee.hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------CK2_BETA  PDB: B:109-140        ------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.13         Exon 2.15e  PDB: B:25-59           --------------------------------------Exon 2.15p  PDB: B:98-123 --------------------------------------------------------------Exon 2.15t             Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------------------Exon 2.15j  PDB: B:59-97 UniProt: 59-97-------------------------Exon 2.15r  PDB: B:123-186 UniProt: 123-186                     --------------------- Transcript 2 (2)
                 4dgl B   7 VSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNF 207
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206 

Chain C from PDB  Type:PROTEIN  Length:334
 aligned with CSK21_HUMAN | P68400 from UniProtKB/Swiss-Prot  Length:391

    Alignment length:334
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331    
          CSK21_HUMAN     2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMG 335
               SCOP domains d4dglc_ C: Protein kinase CK2, alpha subunit                                                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhhhh.....hhh.eeeeeeeee...eeeeeeee.....eeeeeee...hhhhhhhhhhhhhhh........eeeeee......eeeeee..............hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeee....eeee.hhhhhee............hhhhhhhhhhh......hhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhh.....hhhhhh........hhhhhhhhhh....hhhhh.hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------Q--S----------------------------------------------------------------------------------------------------------------------------G----------------------R----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------PROTEIN_KINASE_ATP      -----------------------------------------------------------------------------------PROTEIN_KINAS--------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: C:2-34            -------------------------------------Exon 1.5  PDB: C:72-105           Exon 1.6         Exon 1.7            Exon 1.8  PDB: C:143-170    Exon 1.9  PDB: C:171-207             Exon 1.10  PDB: C:208-241         Exon 1.11b  PDB: C:242-275        -------------------------------------------------Exon 1.13   Transcript 1 (1)
           Transcript 1 (2) --------------------------------Exon 1.4  PDB: C:34-71 UniProt: 34-71 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.12  PDB: C:275-325 UniProt: 275-325         ---------- Transcript 1 (2)
                 4dgl C   2 SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLRQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMG 335
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331    

Chain D from PDB  Type:PROTEIN  Length:328
 aligned with CSK21_HUMAN | P68400 from UniProtKB/Swiss-Prot  Length:391

    Alignment length:328
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322        
          CSK21_HUMAN     3 GPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKD 330
               SCOP domains d4dgld_ D: Protein kinase CK2, alpha subunit                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......................hhhhh.....hhh.eeeeeeeee...eeeeeeee.....eeeeeee...hhhhhhhhhhhhhhh........eeeeee......eeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeee....eeee......ee............hhhhhhhhhhh......hhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhh.....hhhhhh...hhhhhhhhhhhhhhhhh..hhhhh.hhhhhh....hhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------Q--S----------------------------------------------------------------------------------------------------------------------------G----------------------R------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------PROTEIN_KINASE_ATP      -----------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: D:3-34           -------------------------------------Exon 1.5  PDB: D:72-105           Exon 1.6         Exon 1.7            Exon 1.8  PDB: D:143-170    Exon 1.9  PDB: D:171-207             Exon 1.10  PDB: D:208-241         Exon 1.11b  PDB: D:242-275        -------------------------------------------------1.13   Transcript 1 (1)
           Transcript 1 (2) -------------------------------Exon 1.4  PDB: D:34-71 UniProt: 34-71 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.12  PDB: D:275-325 UniProt: 275-325         ----- Transcript 1 (2)
                 4dgl D   3 GPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLRQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKD 330
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4DGL)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4DGL)

(-) Gene Ontology  (56, 68)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (CSK2B_HUMAN | P67870)
molecular function
    GO:0003682    chromatin binding    Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
    GO:0019887    protein kinase regulator activity    Modulates the activity of a protein kinase, an enzyme which phosphorylates a protein.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
biological process
    GO:0016055    Wnt signaling pathway    The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
    GO:0033211    adiponectin-activated signaling pathway    A series of molecular signals initiated by the binding of adiponectin to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0043623    cellular protein complex assembly    The aggregation, arrangement and bonding together of a set of components to form a protein complex, occurring at the level of an individual cell.
    GO:0061154    endothelial tube morphogenesis    The process in which the anatomical structures of a tube are generated and organized from an endothelium. Endothelium refers to the layer of cells lining blood vessels, lymphatics, the heart, and serous cavities, and is derived from bone marrow or mesoderm. Corneal endothelium is a special case, derived from neural crest cells.
    GO:0043537    negative regulation of blood vessel endothelial cell migration    Any process that stops, prevents, or reduces the frequency, rate or extent of the migration of the endothelial cells of blood vessels.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:0032927    positive regulation of activin receptor signaling pathway    Any process that activates or increases the frequency, rate or extent of the activity of any activin receptor signaling pathway.
    GO:0010862    positive regulation of pathway-restricted SMAD protein phosphorylation    Any process that increases the rate, frequency or extent of pathway-restricted SMAD protein phosphorylation. Pathway-restricted SMAD proteins and common-partner SMAD proteins are involved in the transforming growth factor beta receptor signaling pathways.
    GO:0006457    protein folding    The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0051101    regulation of DNA binding    Any process that modulates the frequency, rate or extent of DNA binding. DNA binding is any process in which a gene product interacts selectively with DNA (deoxyribonucleic acid).
    GO:0045859    regulation of protein kinase activity    Any process that modulates the frequency, rate or extent of protein kinase activity.
    GO:1901796    regulation of signal transduction by p53 class mediator    Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0031519    PcG protein complex    A chromatin-associated multiprotein complex containing Polycomb Group proteins. In Drosophila, Polycomb group proteins are involved in the long-term maintenance of gene repression, and PcG protein complexes associate with Polycomb group response elements (PREs) in target genes to regulate higher-order chromatin structure.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0005956    protein kinase CK2 complex    A protein complex that possesses protein serine/threonine kinase activity, and contains two catalytic alpha subunits and two regulatory beta subunits. Protein kinase CK2 complexes are found in nearly every subcellular compartment, and can phosphorylate many protein substrates in addition to casein.

Chain C,D   (CSK21_HUMAN | P68400)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0051879    Hsp90 protein binding    Interacting selectively and non-covalently with Hsp90 proteins, any of a group of heat shock proteins around 90kDa in size.
    GO:0008013    beta-catenin binding    Interacting selectively and non-covalently with the beta subunit of the catenin complex.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0047485    protein N-terminus binding    Interacting selectively and non-covalently with a protein N-terminus, the end of any peptide chain at which the 2-amino (or 2-imino) function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0019888    protein phosphatase regulator activity    Modulates the activity of a protein phosphatase, an enzyme which catalyzes of the removal of a phosphate group from a protein substrate molecule.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0016055    Wnt signaling pathway    The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0061077    chaperone-mediated protein folding    The process of inhibiting aggregation and assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure that is dependent on interaction with a chaperone.
    GO:0071174    mitotic spindle checkpoint    A mitotic cell cycle checkpoint that originates from the spindle and delays the metaphase/anaphase transition of a mitotic nuclear division until the spindle is correctly assembled and oriented, the completion of anaphase until chromosomes are attached to the spindle, or mitotic exit and cytokinesis when the spindle does not form.
    GO:0043154    negative regulation of cysteine-type endopeptidase activity involved in apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of a cysteine-type endopeptidase activity involved in the apoptotic process.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0030177    positive regulation of Wnt signaling pathway    Any process that activates or increases the frequency, rate or extent of Wnt signal transduction.
    GO:0030307    positive regulation of cell growth    Any process that activates or increases the frequency, rate, extent or direction of cell growth.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0045732    positive regulation of protein catabolic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0006457    protein folding    The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:1901796    regulation of signal transduction by p53 class mediator    Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0048511    rhythmic process    Any process pertinent to the generation and maintenance of rhythms in the physiology of an organism.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0016581    NuRD complex    An approximately 2 MDa multi-subunit complex that exhibits ATP-dependent chromatin remodeling activity in addition to histone deacetylase (HDAC) activity, and has been shown to establish transcriptional repression of a number of target genes in vertebrates, invertebrates and fungi. Amongst its subunits, the NuRD complex contains histone deacetylases, histone binding proteins and Mi-2-like proteins.
    GO:0031519    PcG protein complex    A chromatin-associated multiprotein complex containing Polycomb Group proteins. In Drosophila, Polycomb group proteins are involved in the long-term maintenance of gene repression, and PcG protein complexes associate with Polycomb group response elements (PREs) in target genes to regulate higher-order chromatin structure.
    GO:0016580    Sin3 complex    A multiprotein complex that functions broadly in eukaryotic organisms as a transcriptional repressor of protein-coding genes, through the gene-specific deacetylation of histones. Amongst its subunits, the Sin3 complex contains Sin3-like proteins, and a number of core proteins that are shared with the NuRD complex (including histone deacetylases and histone binding proteins). The Sin3 complex does not directly bind DNA itself, but is targeted to specific genes through protein-protein interactions with DNA-binding proteins.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu C:230 - Pro C:231   [ RasMol ]  
    Glu D:230 - Pro D:231   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4dgl
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CSK21_HUMAN | P68400
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  CSK2B_HUMAN | P67870
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  617062
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CSK21_HUMAN | P68400
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CSK2B_HUMAN | P67870
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CSK21_HUMAN | P684001jwh 1na7 1pjk 2pvr 2zjw 3amy 3at2 3at3 3at4 3axw 3bqc 3c13 3fwq 3h30 3juh 3mb6 3mb7 3nga 3nsz 3owj 3owk 3owl 3pe1 3pe2 3pe4 3q04 3q9w 3q9x 3q9y 3q9z 3qa0 3r0t 3rps 3tax 3u4u 3u87 3u9c 3w8l 3war 3wik 3wil 3wow 4fbx 4grb 4gub 4gyw 4gyy 4gz3 4ib5 4kwp 4md7 4md8 4md9 4nh1 4rll 4ub7 4uba 5b0x 5clp 5cqu 5cqw 5cs6 5csh 5csp 5csv 5ct0 5ctp 5cu0 5cu2 5cu3 5cu4 5cu6 5cvf 5cvg 5cvh 5cx9 5h8b 5h8e 5h8g 5hgv 5m44 5m4c 5m4f 5m4i 5mmf 5mmr 5mo5 5mo6 5mo7 5mo8 5mod 5moe 5moh 5mot 5mov 5mow 5mp8 5mpj 5n1v 5nqc
        CSK2B_HUMAN | P678701ds5 1jwh 1qf8 3eed 4md7 4md8 4md9 4nh1

(-) Related Entries Specified in the PDB File

1jwh