Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN PROTEASE-ACTIVATED RECEPTOR 1 (PAR1) BOUND WITH ANTAGONIST VORAPAXAR AT 2.2 ANGSTROM
 
Authors :  C. Zhang, Y. Srinivasan, D. H. Arlow, J. J. Fung, D. Palmer, Y. Zheng, H. F A. Pandey, R. O. Dror, D. E. Shaw, W. I. Weis, S. R. Coughlin, B. K. Kobilk
Date :  07 Aug 12  (Deposition) - 12 Dec 12  (Release) - 14 Aug 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A
Keywords :  High Resolution Structure, Protease-Activated Receptor 1, Inactive Conformation, Antagonist Vorapaxar, G Protein-Coupled Receptor, Signaling Protein, Membrane Protein, Thrombin Receptor-Antagonist Complex, Signaling Protein-Antagonist Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Zhang, Y. Srinivasan, D. H. Arlow, J. J. Fung, D. Palmer, Y. Zheng, H. F. Green, A. Pandey, R. O. Dror, D. E. Shaw, W. I. Weis, S. R. Coughlin, B. K. Kobilka
High-Resolution Crystal Structure Of Human Protease-Activated Receptor 1
Nature V. 492 387 2012
PubMed-ID: 23222541  |  Reference-DOI: 10.1038/NATURE11701

(-) Compounds

Molecule 1 - PROTEINASE-ACTIVATED RECEPTOR 1, LYSOZYME
    ChainsA
    EC Number3.2.1.17
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS, ENTEROBACTERIA PHAGE T4, HOMO SAPIENS
    Organism Taxid9606, 10665, 9606
    Other DetailsCHIMERA PROTEIN OF RESIDUES 86-395 FORM PROTEINASE- ACTIVATED RECEPTOR 1 (P25116, PAR1_HUMAN), LYZOSYME FROM ENTEROBACTERIA PHAGE T4 (P00720, LYS_BPT4) AND RESIDUES 303-395 FROM PROTEINASE-ACTIVATED RECEPTOR 1 (P25116, PAR1_HUMAN)
    SynonymPAR-1, COAGULATION FACTOR II RECEPTOR, THROMBIN RECEPTOR, ENDOLYSIN, LYSIS PROTEIN, MURAMIDASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 12)

Asymmetric/Biological Unit (4, 12)
No.NameCountTypeFull Name
1CL1Ligand/IonCHLORIDE ION
2NA1Ligand/IonSODIUM ION
3OLC9Ligand/Ion(2R)-2,3-DIHYDROXYPROPYL (9Z)-OCTADEC-9-ENOATE
4VPX1Ligand/IonETHYL [(1R,3AR,4AR,6R,8AR,9S,9AS)-9-{(E)-2-[5-(3-FLUOROPHENYL)PYRIDIN-2-YL]ETHENYL}-1-METHYL-3-OXODODECAHYDRONAPHTHO[2,3-C]FURAN-6-YL]CARBAMATE

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWARETYR A:183 , TYR A:187 , PRO A:236 , HIS A:255 , ASP A:256 , VAL A:257 , LEU A:258 , PHE A:271 , ARG A:1080 , LEU A:332 , LEU A:333 , TYR A:337 , ALA A:349 , TYR A:350 , TYR A:353 , HOH A:3004BINDING SITE FOR RESIDUE VPX A 2001
02AC2SOFTWAREPHE A:157 , TYR A:206 , ILE A:284 , ARG A:295 , OLC A:2003BINDING SITE FOR RESIDUE OLC A 2002
03AC3SOFTWARESER A:160 , SER A:164 , OLC A:2002 , OLC A:2004BINDING SITE FOR RESIDUE OLC A 2003
04AC4SOFTWAREPHE A:113 , PRO A:156 , SER A:160 , PHE A:163 , SER A:164 , LEU A:202 , LEU A:229 , PHE A:278 , OLC A:2003 , OLC A:2010BINDING SITE FOR RESIDUE OLC A 2004
05AC5SOFTWAREMET A:122 , VAL A:126 , PHE A:127 , CYS A:365 , PRO A:368 , TYR A:371 , TYR A:372 , SER A:375BINDING SITE FOR RESIDUE OLC A 2005
06AC6SOFTWARETRP A:100 , PRO A:328 , ALA A:348 , PHE A:351 , CYS A:356 , HOH A:3067BINDING SITE FOR RESIDUE OLC A 2006
07AC7SOFTWAREGLY A:327 , PRO A:328 , THR A:343 , THR A:346 , ALA A:348 , CYS A:356BINDING SITE FOR RESIDUE OLC A 2007
08AC8SOFTWAREVAL A:139 , HIS A:143 , SER A:220 , LEU A:224 , ALA A:228BINDING SITE FOR RESIDUE OLC A 2008
09AC9SOFTWAREPRO A:236 , LYS A:240 , TYR A:270 , PHE A:271BINDING SITE FOR RESIDUE OLC A 2009
10BC1SOFTWAREPHE A:163 , PHE A:221 , THR A:222 , OLC A:2004BINDING SITE FOR RESIDUE OLC A 2010
11BC2SOFTWARELYS A:135 , LYS A:307BINDING SITE FOR RESIDUE CL A 2011
12BC3SOFTWARELEU A:144 , ASP A:148 , SER A:189 , ASP A:367 , HOH A:3065 , HOH A:3066BINDING SITE FOR RESIDUE NA A 2012

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:175 -A:254

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3VW7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (5, 5)

Asymmetric/Biological Unit (5, 5)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_014167S166GPAR1_HUMANPolymorphism5893AS166G
2UniProtVAR_049432Y187NPAR1_HUMANPolymorphism2230849AY187N
3UniProtVAR_049433V257LPAR1_HUMANPolymorphism2227832AV257L
4UniProtVAR_060680A268PPAR1_HUMANPolymorphism1055103AA268P
5UniProtVAR_060681A335VPAR1_HUMANPolymorphism17849599AA335V

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1G_PROTEIN_RECEP_F1_1PS00237 G-protein coupled receptors family 1 signature.PAR1_HUMAN188-204  1A:188-204

(-) Exons   (1, 1)

Asymmetric/Biological Unit (1, 1)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003192111aENSE00001259499chr5:76011868-76012220353PAR1_HUMAN1-30300--
1.4bENST000003192114bENSE00001259490chr5:76028139-760316063468PAR1_HUMAN30-4253961A:91-378 (gaps)449

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:442
 aligned with ENLYS_BPT4 | P00720 from UniProtKB/Swiss-Prot  Length:164

    Alignment length:443
                                                                                                                                                                                                                                                                                                                                                                                                                  164                                                                  
                                                                                                                                                                                                                                          1                                                                                                                                                             161     162 |                                                                  
                                     -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -      |  4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154      |  -    | |  -         -         -         -         -         -         -   
          ENLYS_BPT4      - --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAY-------KNL------------------------------------------------------------------    -
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh...eeee....eeee.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....-hhhhhhhhhhh.eeeeee.....eeee..eeee...hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh...hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------G--------------------N----------------------------------------------------------------L----------P----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------V------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3vw7 A   91 DASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMRTLGRASFTCLAIWALAIAGVVPLLLKEQTIQVPGLGITTCHDVLSETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSA-NIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVSSISCCIDPLIYYYASSEC  378
                                   100       110       120       130       140       150       160       170       180       190       200       215       225       235       245       255       265       275       285       295     |1004      1014      1024      1034      1044      1054      1064      1074      1084      1094      1104      1114      1124      1134      1144      1154      |305       315       325       335       345       355       365       375   
                                                                                                                                               208|                                                                                    301 |                                                                                                                                                           1161|                                                                           
                                                                                                                                                214                                                                                     1002                                                                                                                                                             303                                                                           

Chain A from PDB  Type:PROTEIN  Length:442
 aligned with PAR1_HUMAN | P25116 from UniProtKB/Swiss-Prot  Length:425

    Alignment length:447
                                                                                                                                                                                                                                                                                                                                                           303                                                                                                                             
                                                                                                                                                                                                                                            301                                                                                                           302|                                                304                                                                          
                                   100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300|        -         -         -         -         -         -         -         -         -         -         -||       -         -         -         -         -  |    311       321       331       341       351       361       371       
          PAR1_HUMAN     91 DASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLKEQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSA-------------------------------------------------------------------------------------------------------------VA--------------------------------------------------NRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVSSISCCIDPLIYYYASSEC  378
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..-----.hhhhhhhhhhhhhhhhhhhhhhhhh...eeee....eeee.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhh.eeeeee.....eeee..eeee...hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh...hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------G--------------------N---------------------------------------------------------------------L----------P---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------V------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------G_PROTEIN_RECEP_F--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.4b  PDB: A:91-378 (gaps) UniProt: 30-425                                                                                                                                                                                                                                                                                                                                                                                                                 Transcript 1
                3vw7 A   91 DASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPM-----RTLGRASFTCLAIWALAIAGVVPLLLKEQTIQVPGLGITTCHDVLSETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSANIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVSSISCCIDPLIYYYASSEC  378
                                   100       110       120       130       140       150       160       170       180       190       200       | -   |   220       230       240       250       260       270       280       290       300||    1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      1130      1140      1150      1160||     311       321       331       341       351       361       371       
                                                                                                                                               208   214                                                                                    301|                                                                                                                                                           1161|                                                                           
                                                                                                                                                                                                                                            1002                                                                                                                                                             303                                                                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3VW7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3VW7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3VW7)

(-) Gene Ontology  (80, 80)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (PAR1_HUMAN | P25116)
molecular function
    GO:0001965    G-protein alpha-subunit binding    Interacting selectively and non-covalently with a G-protein alpha subunit. The alpha subunit binds a guanine nucleotide.
    GO:0031681    G-protein beta-subunit binding    Interacting selectively and non-covalently with a G-protein beta subunit.
    GO:0004930    G-protein coupled receptor activity    Combining with an extracellular signal and transmitting the signal across the membrane by activating an associated G-protein; promotes the exchange of GDP for GTP on the alpha subunit of a heterotrimeric G-protein complex.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0004871    signal transducer activity    Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
    GO:0015057    thrombin-activated receptor activity    A G-protein-coupled receptor activity that is activated by cleavage by thrombin, which exposes a tethered ligand corresponding to the new N-terminus, which binds to the receptor and activates it.
biological process
    GO:0007186    G-protein coupled receptor signaling pathway    A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
    GO:0007262    STAT protein import into nucleus    The directed movement of dimerized STAT (Signal Transducers and Activators of Transcription) proteins into the nucleus following activation by members of the janus activated kinase (JAK) family of tyrosine kinases.
    GO:0000186    activation of MAPKK activity    The initiation of the activity of the inactive enzyme MAP kinase kinase (MAPKK).
    GO:0006919    activation of cysteine-type endopeptidase activity involved in apoptotic process    Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase in the context of an apoptotic process.
    GO:0009653    anatomical structure morphogenesis    The process in which anatomical structures are generated and organized. Morphogenesis pertains to the creation of form.
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0002248    connective tissue replacement involved in inflammatory response wound healing    The series of events leading to growth of connective tissue when loss of tissues that are incapable of regeneration occurs, or when fibrinous exudate cannot be adequately cleared that contribute to an inflammatory response.
    GO:0007529    establishment of synaptic specificity at neuromuscular junction    The biological process in which a synapse between a motor neuron and a muscle is initially formed.
    GO:0007599    hemostasis    The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
    GO:0048873    homeostasis of number of cells within a tissue    Any biological process involved in the maintenance of the steady-state number of cells within a population of cells in a tissue.
    GO:0006954    inflammatory response    The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:0003105    negative regulation of glomerular filtration    Any process that stops, prevents, or reduces the frequency, rate or extent of glomerular filtration. Glomerular filtration is the processs whereby blood is filtered by the glomerulus into the renal tubule.
    GO:0043524    negative regulation of neuron apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons.
    GO:1900134    negative regulation of renin secretion into blood stream    Any process that stops, prevents or reduces the frequency, rate or extent of renin secretion into blood stream.
    GO:0007200    phospholipase C-activating G-protein coupled receptor signaling pathway    The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds with activation of phospholipase C (PLC) and a subsequent increase in the concentration of inositol trisphosphate (IP3) and diacylglycerol (DAG).
    GO:0030168    platelet activation    A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
    GO:0060155    platelet dense granule organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a platelet dense granule. A platelet dense granule is an electron-dense granule occurring in blood platelets that stores and secretes adenosine nucleotides and serotonin. They contain a highly condensed core consisting of serotonin, histamine, calcium, magnesium, ATP, ADP, pyrophosphate and membrane lysosomal proteins.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0043123    positive regulation of I-kappaB kinase/NF-kappaB signaling    Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
    GO:0046427    positive regulation of JAK-STAT cascade    Any process that activates or increases the frequency, rate or extent of the JAK-STAT signaling pathway activity.
    GO:0043410    positive regulation of MAPK cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the MAPK cascade.
    GO:0035025    positive regulation of Rho protein signal transduction    Any process that activates or increases the frequency, rate or extent of Rho protein signal transduction.
    GO:0030194    positive regulation of blood coagulation    Any process that activates or increases the frequency, rate or extent of blood coagulation.
    GO:0051928    positive regulation of calcium ion transport    Any process that activates or increases the frequency, rate or extent of the directed movement of calcium ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0030335    positive regulation of cell migration    Any process that activates or increases the frequency, rate or extent of cell migration.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0032967    positive regulation of collagen biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of collagen, any of a group of fibrous proteins of very high tensile strength that form the main component of connective tissue in animals.
    GO:0043280    positive regulation of cysteine-type endopeptidase activity involved in apoptotic process    Any process that activates or increases the activity of a cysteine-type endopeptidase involved in the apoptotic process.
    GO:0007204    positive regulation of cytosolic calcium ion concentration    Any process that increases the concentration of calcium ions in the cytosol.
    GO:0051482    positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway    Any process that increases the concentration of calcium ions in the cytosol that occurs as part of a PLC-activating G-protein coupled receptor signaling pathway. G-protein-activated PLC hydrolyses phosphatidylinositol-bisphosphate (PIP2) to release diacylglycerol (DAG) and inositol trisphosphate (IP3). IP3 then binds to calcium release channels in the endoplasmic reticulum (ER) to trigger calcium ion release into the cytosol.
    GO:2000778    positive regulation of interleukin-6 secretion    Any process that activates or increases the frequency, rate or extent of interleukin-6 secretion.
    GO:2000484    positive regulation of interleukin-8 secretion    Any process that activates or increases the frequency, rate or extent of interleukin-8 secretion.
    GO:0014068    positive regulation of phosphatidylinositol 3-kinase signaling    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
    GO:0051281    positive regulation of release of sequestered calcium ion into cytosol    Any process that activates or increases the frequency, rate or extent of the release into the cytosolic compartment of calcium ions sequestered in the endoplasmic reticulum or mitochondria.
    GO:0045987    positive regulation of smooth muscle contraction    Any process that activates or increases the frequency, rate or extent of smooth muscle contraction.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0045907    positive regulation of vasoconstriction    Any process that activates or increases the frequency, rate or extent of vasoconstriction.
    GO:0007205    protein kinase C-activating G-protein coupled receptor signaling pathway    The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds with activation of protein kinase C (PKC). PKC is activated by second messengers including diacylglycerol (DAG).
    GO:0030193    regulation of blood coagulation    Any process that modulates the frequency, rate or extent of blood coagulation.
    GO:0032651    regulation of interleukin-1 beta production    Any process that modulates the frequency, rate, or extent of interleukin-1 beta production.
    GO:0051930    regulation of sensory perception of pain    Any process that modulates the frequency, rate or extent of the sensory perception of pain, the series of events required for an organism to receive a painful stimulus, convert it to a molecular signal, and recognize and characterize the signal.
    GO:0051209    release of sequestered calcium ion into cytosol    The process in which calcium ions sequestered in the endoplasmic reticulum, Golgi apparatus or mitochondria are released into the cytosolic compartment.
    GO:0032496    response to lipopolysaccharide    Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
    GO:0009611    response to wounding    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to the organism.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0070493    thrombin-activated receptor signaling pathway    The series of molecular signals generated as a consequence of a thrombin-activated receptor binding to one of its physiological ligands.
    GO:0007260    tyrosine phosphorylation of STAT protein    The process of introducing a phosphate group to a tyrosine residue of a STAT (Signal Transducer and Activator of Transcription) protein.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0005901    caveola    A membrane raft that forms small pit, depression, or invagination that communicates with the outside of a cell and extends inward, indenting the cytoplasm and the cell membrane. Examples include flask-shaped invaginations of the plasma membrane in adipocytes associated with caveolin proteins, and minute pits or incuppings of the cell membrane formed during pinocytosis. Caveolae may be pinched off to form free vesicles within the cytoplasm.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005769    early endosome    A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005770    late endosome    A prelysosomal endocytic organelle differentiated from early endosomes by lower lumenal pH and different protein composition. Late endosomes are more spherical than early endosomes and are mostly juxtanuclear, being concentrated near the microtubule organizing center.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0031594    neuromuscular junction    The junction between the axon of a motor neuron and a muscle fiber. In response to the arrival of action potentials, the presynaptic button releases molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane of the muscle fiber, leading to a change in post-synaptic potential.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0031094    platelet dense tubular network    A network of membrane-bounded compartments found in blood platelets, where they regulate platelet activation by sequestering or releasing calcium. The dense tubular network exists as thin elongated membranes in resting platelets, and undergoes a major ultrastructural change, to a rounded vesicular form, upon addition of thrombin.
    GO:0045211    postsynaptic membrane    A specialized area of membrane facing the presynaptic membrane on the tip of the nerve ending and separated from it by a minute cleft (the synaptic cleft). Neurotransmitters cross the synaptic cleft and transmit the signal to the postsynaptic membrane.

Chain A   (ENLYS_BPT4 | P00720)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016798    hydrolase activity, acting on glycosyl bonds    Catalysis of the hydrolysis of any glycosyl bond.
    GO:0003796    lysozyme activity    Catalysis of the hydrolysis of the beta-(1->4) linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan.
biological process
    GO:0016998    cell wall macromolecule catabolic process    The chemical reactions and pathways resulting in the breakdown of macromolecules that form part of a cell wall.
    GO:0019835    cytolysis    The rupture of cell membranes and the loss of cytoplasm.
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0009253    peptidoglycan catabolic process    The chemical reactions and pathways resulting in the breakdown of peptidoglycans, any of a class of glycoconjugates found in bacterial cell walls.
    GO:0019076    viral release from host cell    The dissemination of mature viral particles from the host cell, e.g. by cell lysis or the budding of virus particles from the cell membrane.
cellular component
    GO:0030430    host cell cytoplasm    The cytoplasm of a host cell.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OLC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    VPX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3vw7)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3vw7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ENLYS_BPT4 | P00720
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PAR1_HUMAN | P25116
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.17
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ENLYS_BPT4 | P00720
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PAR1_HUMAN | P25116
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ENLYS_BPT4 | P00720102l 103l 104l 107l 108l 109l 110l 111l 112l 113l 114l 115l 118l 119l 120l 122l 123l 125l 126l 127l 128l 129l 130l 131l 137l 138l 139l 140l 141l 142l 143l 144l 145l 146l 147l 148l 149l 150l 151l 152l 155l 156l 157l 158l 159l 160l 161l 162l 163l 164l 165l 166l 167l 168l 169l 170l 171l 172l 173l 174l 175l 176l 177l 178l 180l 181l 182l 183l 184l 185l 186l 187l 188l 189l 190l 191l 192l 195l 196l 197l 198l 199l 1b6i 1c60 1c61 1c62 1c63 1c64 1c65 1c66 1c67 1c68 1c69 1c6a 1c6b 1c6c 1c6d 1c6e 1c6f 1c6g 1c6h 1c6i 1c6j 1c6k 1c6l 1c6m 1c6n 1c6p 1c6q 1c6t 1ctw 1cu0 1cu2 1cu3 1cu5 1cu6 1cup 1cuq 1cv0 1cv1 1cv3 1cv4 1cv5 1cv6 1cvk 1cx6 1cx7 1d2w 1d2y 1d3f 1d3j 1d3m 1d3n 1d9w 1dya 1dyb 1dyc 1dyd 1dye 1dyf 1dyg 1epy 1g06 1g07 1g0g 1g0j 1g0k 1g0l 1g0m 1g0p 1g0q 1g1v 1g1w 1i6s 1jqu 1jtm 1jtn 1kni 1ks3 1kw5 1kw7 1ky0 1ky1 1l00 1l01 1l02 1l03 1l04 1l05 1l06 1l07 1l08 1l09 1l0j 1l0k 1l10 1l11 1l12 1l13 1l14 1l15 1l16 1l17 1l18 1l19 1l20 1l21 1l22 1l23 1l24 1l25 1l26 1l27 1l28 1l29 1l30 1l31 1l32 1l33 1l34 1l35 1l36 1l37 1l38 1l39 1l40 1l41 1l42 1l43 1l44 1l45 1l46 1l47 1l48 1l49 1l50 1l51 1l52 1l53 1l54 1l55 1l56 1l57 1l58 1l59 1l60 1l61 1l62 1l63 1l64 1l65 1l66 1l67 1l68 1l69 1l70 1l71 1l72 1l73 1l74 1l75 1l76 1l77 1l79 1l80 1l81 1l82 1l83 1l84 1l85 1l86 1l87 1l88 1l89 1l90 1l91 1l92 1l93 1l94 1l95 1l96 1l97 1l98 1l99 1lgu 1lgw 1lgx 1li2 1li3 1li6 1llh 1lpy 1lw9 1lwg 1lwk 1lyd 1lye 1lyf 1lyg 1lyh 1lyi 1lyj 1nhb 1ov5 1ov7 1ovh 1ovj 1ovk 1owy 1owz 1oyu 1p2l 1p2r 1p36 1p37 1p3n 1p46 1p56 1p5c 1p64 1p6y 1p7s 1pqd 1pqi 1pqj 1pqk 1pqm 1pqo 1qs5 1qs9 1qsb 1qsq 1qt3 1qt4 1qt5 1qt6 1qt7 1qt8 1qtb 1qtc 1qtd 1qth 1qtv 1qtz 1qud 1qug 1quh 1quo 1ssw 1ssy 1swy 1swz 1sx2 1sx7 1t6h 1t8a 1t8f 1t8g 1t97 1tla 1xep 1zur 1zwn 1zyt 200l 201l 205l 206l 209l 210l 211l 212l 213l 214l 215l 216l 217l 218l 219l 220l 221l 222l 223l 224l 225l 226l 227l 228l 229l 230l 231l 232l 233l 234l 235l 236l 237l 238l 239l 240l 241l 242l 243l 244l 245l 246l 247l 248l 249l 250l 251l 252l 253l 254l 255l 256l 257l 258l 259l 260l 261l 262l 2a4t 2b6t 2b6w 2b6x 2b6y 2b6z 2b70 2b72 2b73 2b74 2b75 2b7x 2cuu 2f2q 2f32 2f47 2huk 2hul 2hum 2igc 2l78 2lc9 2lcb 2lzm 2ntg 2nth 2o4w 2o79 2o7a 2oe4 2oe7 2oe9 2oea 2oty 2otz 2ou0 2ou8 2ou9 2q9d 2q9e 2qar 2qb0 2ray 2raz 2rb0 2rb1 2rb2 2rbn 2rbo 2rbp 2rbq 2rbr 2rbs 2rh1 3c7w 3c7y 3c7z 3c80 3c81 3c82 3c83 3c8q 3c8r 3c8s 3cdo 3cdq 3cdr 3cdt 3cdv 3d4s 3dke 3dmv 3dmx 3dmz 3dn0 3dn1 3dn2 3dn3 3dn4 3dn6 3dn8 3dna 3eml 3f8v 3f9l 3fa0 3fad 3fi5 3g3v 3g3w 3g3x 3gui 3guj 3guk 3gul 3gum 3gun 3guo 3gup 3hh3 3hh4 3hh5 3hh6 3ht6 3ht7 3ht8 3ht9 3htb 3htd 3htf 3htg 3hu8 3hu9 3hua 3huk 3huq 3hwl 3jr6 3k2r 3l2x 3l64 3lzm 3ny8 3ny9 3nya 3odu 3oe0 3oe6 3oe8 3oe9 3p0g 3pbl 3pds 3qak 3run 3rze 3sb5 3sb6 3sb7 3sb8 3sb9 3sba 3sbb 3sn6 3uon 3v2w 3v2y 4arj 4daj 4djh 4dkl 4e97 4ej4 4ekp 4ekq 4ekr 4eks 4epi 4exm 4gbr 4grv 4htt 4i7j 4i7k 4i7l 4i7m 4i7n 4i7o 4i7p 4i7q 4i7r 4i7s 4i7t 4iap 4k5y 4lde 4ldl 4ldo 4lzm 4n9n 4oo9 4phu 4rws 4s0w 4tn3 4u14 4w51 4w52 4w53 4w54 4w55 4w56 4w57 4w58 4w59 4w8f 4wtv 4xee 4xes 4yx7 4yxa 4yxc 4zwj 5b2g 5cgc 5cgd 5cxv 5d5a 5d5b 5d6l 5dgy 5dsg 5ee7 5eut 5ewx 5g27 5glh 5gli 5i14 5jdt 5jea 5jgn 5jgr 5jgu 5jgv 5jgx 5jgz 5jqh 5jws 5jwt 5jwu 5jwv 5jww 5kgr 5khz 5ki1 5ki2 5ki3 5ki8 5kig 5kii 5kim 5kio 5lwo 5lzm 5t04 5t1a 5tzr 5tzy 5vew 5vex 6lzm 7lzm
        PAR1_HUMAN | P251161nrn 1nro 1nrp 1nrq 1nrr 3bef 3hki 3hkj 3lu9

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3VW7)