Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE CXCR4 CHEMOKINE RECEPTOR IN COMPLEX WITH A SMALL MOLECULE ANTAGONIST IT1T IN P1 SPACEGROUP
 
Authors :  B. Wu, C. D. Mol, G. W. Han, V. Katritch, E. Y. T. Chien, W. Liu, V. Cherezov R. C. Stevens, Accelerated Technologies Center For Gene To 3D (Atcg3D), Gpcr Network (Gpcr)
Date :  12 Aug 10  (Deposition) - 27 Oct 10  (Release) - 02 May 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.10
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  B,C  (1x)
Biol. Unit 2:  A,B,C  (1x)
Biol. Unit 3:  A  (1x)
Keywords :  Structural Genomics, Psi-2, Protein Structure Initiative, Accelerated Technologies Center For Gene To 3D Structure, Atcg3D, 7Tm, G Protein-Coupled Receptor, Gpcr, Signal Transduction, Hydrolase, Cancer, Hiv-1 Co-Receptor, Chemotaxis, Chemokine, Cxcl12, Sdf1, Isothiourea, Chimera, T4L Fusion, Membrane Protein, Transmembrane, Singnaling Protein, Psi-Biology, Gpcr Network, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. Wu, E. Y. Chien, C. D. Mol, G. Fenalti, W. Liu, V. Katritch, R. Abagyan A. Brooun, P. Wells, F. C. Bi, D. J. Hamel, P. Kuhn, T. M. Handel, V. Cherezov, R. C. Stevens
Structures Of The Cxcr4 Chemokine Gpcr With Small-Molecule And Cyclic Peptide Antagonists.
Science V. 330 1066 2010
PubMed-ID: 20929726  |  Reference-DOI: 10.1126/SCIENCE.1194396

(-) Compounds

Molecule 1 - C-X-C CHEMOKINE RECEPTOR TYPE 4, LYSOZYME CHIMERA
    ChainsA, B, C
    EC Number3.2.1.17
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System PlasmidPFASTBAC
    Expression System StrainSF9
    Expression System Taxid7108
    Expression System Vector TypeBACMID
    FragmentCXCR4 RESIDUES 2-229, LYSOZYME RESIDUES 1002-1161, CXCR4 RESIDUES 230-319
    GeneCXCR4, CXCR4_HUMAN,E
    MutationYES
    Organism ScientificHOMO SAPIENS, ENTEROBACTERIA PHAGE T4
    Organism Taxid9606, 10665
    SynonymCXC-R4, CXCR-4, STROMAL CELL-DERIVED FACTOR 1 RECEPTOR, SDF- 1 RECEPTOR, FUSIN, LEUKOCYTE-DERIVED SEVEN TRANSMEMBRANE DOMAIN RECEPTOR, LESTR, LCR1, FB22, NPYRL, HM89, LYSIS PROTEIN, MURAMIDASE, ENDOLYSIN

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (1x) BC
Biological Unit 2 (1x)ABC
Biological Unit 3 (1x)A  

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 3)

Asymmetric Unit (1, 3)
No.NameCountTypeFull Name
1ITD3Ligand/Ion(6,6-DIMETHYL-5,6-DIHYDROIMIDAZO[2,1-B][1,3]THIAZOL-3-YL)METHYL N,N'-DICYCLOHEXYLIMIDOTHIOCARBAMATE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1ITD2Ligand/Ion(6,6-DIMETHYL-5,6-DIHYDROIMIDAZO[2,1-B][1,3]THIAZOL-3-YL)METHYL N,N'-DICYCLOHEXYLIMIDOTHIOCARBAMATE
Biological Unit 2 (1, 3)
No.NameCountTypeFull Name
1ITD3Ligand/Ion(6,6-DIMETHYL-5,6-DIHYDROIMIDAZO[2,1-B][1,3]THIAZOL-3-YL)METHYL N,N'-DICYCLOHEXYLIMIDOTHIOCARBAMATE
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1ITD1Ligand/Ion(6,6-DIMETHYL-5,6-DIHYDROIMIDAZO[2,1-B][1,3]THIAZOL-3-YL)METHYL N,N'-DICYCLOHEXYLIMIDOTHIOCARBAMATE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETRP A:94 , ASP A:97 , TRP A:102 , VAL A:112 , TYR A:116 , CYS A:186 , ASP A:187 , GLU A:288BINDING SITE FOR RESIDUE ITD A 1500
2AC2SOFTWARETRP B:94 , ASP B:97 , TYR B:116 , ARG B:183 , ILE B:185 , CYS B:186 , ASP B:187 , ARG B:188 , GLU B:288BINDING SITE FOR RESIDUE ITD B 1500
3AC3SOFTWARETRP C:94 , ASP C:97 , TYR C:116 , ARG C:183 , CYS C:186 , ASP C:187 , GLU C:288BINDING SITE FOR RESIDUE ITD C 1500

(-) SS Bonds  (6, 6)

Asymmetric Unit
No.Residues
1A:28 -A:274
2A:109 -A:186
3B:28 -B:274
4B:109 -B:186
5C:28 -C:274
6C:109 -C:186

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3OE8)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3OE8)

(-) PROSITE Motifs  (1, 3)

Asymmetric Unit (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1G_PROTEIN_RECEP_F1_1PS00237 G-protein coupled receptors family 1 signature.CXCR4_HUMAN122-138
 
 
  3A:122-138
B:122-138
C:122-138
Biological Unit 1 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1G_PROTEIN_RECEP_F1_1PS00237 G-protein coupled receptors family 1 signature.CXCR4_HUMAN122-138
 
 
  2-
B:122-138
C:122-138
Biological Unit 2 (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1G_PROTEIN_RECEP_F1_1PS00237 G-protein coupled receptors family 1 signature.CXCR4_HUMAN122-138
 
 
  3A:122-138
B:122-138
C:122-138
Biological Unit 3 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1G_PROTEIN_RECEP_F1_1PS00237 G-protein coupled receptors family 1 signature.CXCR4_HUMAN122-138
 
 
  1A:122-138
-
-

(-) Exons   (0, 0)

(no "Exon" information available for 3OE8)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:433
 aligned with CXCR4_HUMAN | P61073 from UniProtKB/Swiss-Prot  Length:352

    Alignment length:439
                                                                                                                                                                                                                                                                         231                                                                                                                                                                                                       
                                                                                                                                                                                                                                    229                                 230|                                                                                                                           232                                                                         
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226  |      -         -         -       231         -         -         -         -         -         -         -         -         -         -         -         -     | 236       246       256       266       276       286       296         
         CXCR4_HUMAN     27 PCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHS-----------------------------------KG-----------------------------------------------------------------------------------------------------------------------------HQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFL  305
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..------.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheeeeee..eeeeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhh..eeeeee.....eeee..eeee...hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh....hhhhhhh.hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------G_PROTEIN_RECEP_F--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3oe8 A   27 PC------NFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVWILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSGSNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFL  305
                             |      36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226  ||||1006      1016      1026      1036      1046      1056      1066      1076      1086      1096      1106      1116      1126      1136      1146      1156    || 236       246       256       266       276       286       296         
                             |     35                                                                                                                                                                                               229|||                                                                                                                                                           1161|                                                                         
                            28                                                                                                                                                                                                       900||                                                                                                                                                             232                                                                         
                                                                                                                                                                                                                                      901|                                                                                                                                                                                                                                         
                                                                                                                                                                                                                                      1002                                                                                                                                                                                                                                         

Chain A from PDB  Type:PROTEIN  Length:433
 aligned with ENLYS_BPT4 | P00720 from UniProtKB/Swiss-Prot  Length:164

    Alignment length:434
                                                                                                                                                                                                                                                                                                                                                                                                        164                                                                   
                                                                                                                                                                                                                                   1                                                                                                                                                             161  162 |                                                                   
                                     -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         1        11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161    | |  -         -         -         -         -         -         -    
          ENLYS_BPT4      - -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAY----KNL-------------------------------------------------------------------    -
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheeeeee..eeeeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....-.hhhhhhhhh..eeeeee.....eeee..eeee...hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh....hhhhhhh.hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3oe8 A   27 PCNFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVWILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSGS-NIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFL  305
                             ||     42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222      |||-|     1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161|      241       251       261       271       281       291       301    
                            28|                                                                                                                                                                                               229|| |                                                                                                                                                           1161|                                                                         
                             35                                                                                                                                                                                                900| |                                                                                                                                                             232                                                                         
                                                                                                                                                                                                                                901 |                                                                                                                                                                                                                                         
                                                                                                                                                                                                                                 1002                                                                                                                                                                                                                                         

Chain B from PDB  Type:PROTEIN  Length:426
 aligned with CXCR4_HUMAN | P61073 from UniProtKB/Swiss-Prot  Length:352

    Alignment length:437
                                                                                                                                                                                                                                                                    229                                                                                                                                                                                                          
                                                                                                                                                                                                                                 226                              227 |                                                                                                                             230                                                                          
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226         -         -         -  | |    -         -         -         -         -         -         -         -         -         -         -         -         -  |    237       247       257       267       277       287       297       
         CXCR4_HUMAN     27 PCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKL--------------------------------SHS-------------------------------------------------------------------------------------------------------------------------------KGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAF  304
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...---...hhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..---..hhhhhhhhhhhhhhhhhhhhhhhhhhhheeeee....eeeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.....eeee..ee......hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...-----.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------G_PROTEIN_RECEP_F------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3oe8 B   27 PCF---NANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVWILAFISLDRYLAIVHA---QRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYGSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFIL-----QGCEFENTVHKWISITEALAFFHCCLNPILYAF  304
                              |   | 36        46        56        66        76        86        96       106       116       126       136    |  146       156       166       176       186       196       206       216       226|     1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161|||    237       247       257        |-    |  277       287       297       
                             29  33                                                                                                         141 145                                                                              226|                                                                                                                                                           1161|||                                 266   272                                
                                                                                                                                                                                                                                 1002                                                                                                                                                            1200||                                                                          
                                                                                                                                                                                                                                                                                                                                                                                                  1201|                                                                          
                                                                                                                                                                                                                                                                                                                                                                                                    230                                                                          

Chain B from PDB  Type:PROTEIN  Length:426
 aligned with ENLYS_BPT4 | P00720 from UniProtKB/Swiss-Prot  Length:164

    Alignment length:426
                                                                                                                                                                                                                                                                                                                                                                                                      164                                                             
                                                                                                                                                                                                                             1                                                                                                                                                             161      162 |                                                             
                                     -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -   |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157   |     -  | |    -         -         -         -         -         -      
          ENLYS_BPT4      - -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAY--------KNL-------------------------------------------------------------    -
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhheeeee....eeeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.....eeee..ee......hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3oe8 B   27 PCFNANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVWILAFISLDRYLAIVHAQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYGSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILQGCEFENTVHKWISITEALAFFHCCLNPILYAF  304
                              ||    39        49        59        69        79        89        99       109       119       129       139 ||    152       162       172       182       192       202       212       222   || 1007      1017      1027      1037      1047      1057      1067      1077      1087      1097      1107      1117      1127      1137      1147      1157   ||||233       243       253       263  ||   278       288       298      
                             29|                                                                                                         141|                                                                              226|                                                                                                                                                           1161|||                                 266|                                
                              33                                                                                                          145                                                                              1002                                                                                                                                                            1200||                                  272                                
                                                                                                                                                                                                                                                                                                                                                                                            1201|                                                                     
                                                                                                                                                                                                                                                                                                                                                                                              230                                                                     

Chain C from PDB  Type:PROTEIN  Length:428
 aligned with CXCR4_HUMAN | P61073 from UniProtKB/Swiss-Prot  Length:352

    Alignment length:439
                                                                                                                                                                                                                                  227                                                                                                                                                              228                                                                             
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226|        -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         - |     236       246       256       266       276       286       296         
         CXCR4_HUMAN     27 PCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLS----------------------------------------------------------------------------------------------------------------------------------------------------------------HSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFL  305
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) CXC      R4_----------------7tm_1-3oe8C01 C:55-302                                                                                                                                                                                                                                                                                                                                                                                                  --- Pfam domains (1)
           Pfam domains (2) CXC      R4_----------------7tm_1-3oe8C02 C:55-302                                                                                                                                                                                                                                                                                                                                                                                                  --- Pfam domains (2)
           Pfam domains (3) CXC      R4_----------------7tm_1-3oe8C03 C:55-302                                                                                                                                                                                                                                                                                                                                                                                                  --- Pfam domains (3)
         Sec.struct. author ...------hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..---.hhhhhhhhhhhhhhhhhhhhhhhhhhhhheeee..--..eeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh......ee.....eee...ee........hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------G_PROTEIN_RECEP_F--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3oe8 C   27 PCF------FNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVWILAFISLDRYLAIVHA---QRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA--RYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYGSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFL  305
                              |     36        46        56        66        76        86        96       106       116       126       136    |  146       156       166       176   |  |186       196       206       216       226||    1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      1130      1140      1150      1160||||   236       246       256       266       276       286       296         
                             29     36                                                                                                      141 145                                180  |                                         227|                                                                                                                                                           1161|||                                                                           
                                                                                                                                                                                      183                                         1002                                                                                                                                                            1200||                                                                           
                                                                                                                                                                                                                                                                                                                                                                                                   1201|                                                                           
                                                                                                                                                                                                                                                                                                                                                                                                     230                                                                           

Chain C from PDB  Type:PROTEIN  Length:428
 aligned with ENLYS_BPT4 | P00720 from UniProtKB/Swiss-Prot  Length:164

    Alignment length:428
                                                                                                                                                                                                                         2                                                                                                                                                                        164                                                                   
                                                                                                                                                                                                                        1| 3                                                                                                                                                           161      162 |                                                                   
                                     -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -         -        |2 |      11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       163|        -         -         -         -         -         -        
          ENLYS_BPT4      - --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MN-IFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAY--------KNL-------------------------------------------------------------------    -
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) CXCR4_----------------7tm_1-3oe8C01 C:55-302                                                                                                                                                                                                                                                                                                                                                                                             --- Pfam domains (1)
           Pfam domains (2) CXCR4_----------------7tm_1-3oe8C02 C:55-302                                                                                                                                                                                                                                                                                                                                                                                             --- Pfam domains (2)
           Pfam domains (3) CXCR4_----------------7tm_1-3oe8C03 C:55-302                                                                                                                                                                                                                                                                                                                                                                                             --- Pfam domains (3)
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhheeee....eeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh......ee.....eee...ee........hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3oe8 C   27 PCFFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVWILAFISLDRYLAIVHAQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEARYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYGSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFL  305
                              ||    42        52        62        72        82        92       102       112       122       132       145       155       165       175    || 187       197       207       217       227|     1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161|||    237       247       257       267       277       287       297        
                             29|                                                                                                      141|                                180|                                         227|                                                                                                                                                           1161|||                                                                           
                              36                                                                                                       145                                 183                                         1002                                                                                                                                                            1200||                                                                           
                                                                                                                                                                                                                                                                                                                                                                                        1201|                                                                           
                                                                                                                                                                                                                                                                                                                                                                                          230                                                                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3OE8)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3OE8)

(-) Pfam Domains  (2, 6)

Asymmetric Unit
(-)
Clan: GPCR_A (90)
(-)
Family: 7tm_1 (47)
1a7tm_1-3oe8C01C:55-302
1b7tm_1-3oe8C02C:55-302
1c7tm_1-3oe8C03C:55-302

(-) Gene Ontology  (65, 65)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (ENLYS_BPT4 | P00720)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016798    hydrolase activity, acting on glycosyl bonds    Catalysis of the hydrolysis of any glycosyl bond.
    GO:0003796    lysozyme activity    Catalysis of the hydrolysis of the beta-(1->4) linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan.
biological process
    GO:0016998    cell wall macromolecule catabolic process    The chemical reactions and pathways resulting in the breakdown of macromolecules that form part of a cell wall.
    GO:0019835    cytolysis    The rupture of cell membranes and the loss of cytoplasm.
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0009253    peptidoglycan catabolic process    The chemical reactions and pathways resulting in the breakdown of peptidoglycans, any of a class of glycoconjugates found in bacterial cell walls.
    GO:0019076    viral release from host cell    The dissemination of mature viral particles from the host cell, e.g. by cell lysis or the budding of virus particles from the cell membrane.
cellular component
    GO:0030430    host cell cytoplasm    The cytoplasm of a host cell.

Chain A,B,C   (CXCR4_HUMAN | P61073)
molecular function
    GO:0016494    C-X-C chemokine receptor activity    Combining with a C-X-C chemokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity. A C-X-C chemokine has a single amino acid between the first two cysteines of the characteristic four cysteine motif.
    GO:0004930    G-protein coupled receptor activity    Combining with an extracellular signal and transmitting the signal across the membrane by activating an associated G-protein; promotes the exchange of GDP for GTP on the alpha subunit of a heterotrimeric G-protein complex.
    GO:0003779    actin binding    Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
    GO:0004950    chemokine receptor activity    Combining with a chemokine, and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity. Chemokines are a family of small chemotactic cytokines; their name is derived from their ability to induce directed chemotaxis in nearby responsive cells. All chemokines possess a number of conserved cysteine residues involved in intramolecular disulfide bond formation. Some chemokines are considered pro-inflammatory and can be induced during an immune response to recruit cells of the immune system to a site of infection, while others are considered homeostatic and are involved in controlling the migration of cells during normal processes of tissue maintenance or development. Chemokines are found in all vertebrates, some viruses and some bacteria.
    GO:0015026    coreceptor activity    Combining with an extracellular or intracellular messenger, and in cooperation with a nearby primary receptor, initiating a change in cell activity.
    GO:0019955    cytokine binding    Interacting selectively and non-covalently with a cytokine, any of a group of proteins that function to control the survival, growth and differentiation of tissues and cells, and which have autocrine and paracrine activity.
    GO:0008144    drug binding    Interacting selectively and non-covalently with a drug, any naturally occurring or synthetic substance, other than a nutrient, that, when administered or applied to an organism, affects the structure or functioning of the organism; in particular, any such substance used in the diagnosis, prevention, or treatment of disease.
    GO:0032027    myosin light chain binding    Interacting selectively and non-covalently with a light chain of a myosin complex.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004871    signal transducer activity    Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
    GO:0043130    ubiquitin binding    Interacting selectively and non-covalently with ubiquitin, a protein that when covalently bound to other cellular proteins marks them for proteolytic degradation.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
    GO:0001618    virus receptor activity    Combining with a virus component and mediating entry of the virus into the cell.
biological process
    GO:0007186    G-protein coupled receptor signaling pathway    A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
    GO:0000187    activation of MAPK activity    The initiation of the activity of the inactive enzyme MAP kinase (MAPK).
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0019722    calcium-mediated signaling    Any intracellular signal transduction in which the signal is passed on within the cell via calcium ions.
    GO:0060048    cardiac muscle contraction    Muscle contraction of cardiac muscle tissue.
    GO:0016477    cell migration    The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
    GO:0071345    cellular response to cytokine stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
    GO:0070098    chemokine-mediated signaling pathway    A series of molecular signals initiated by the binding of a chemokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0006935    chemotaxis    The directed movement of a motile cell or organism, or the directed growth of a cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).
    GO:0002407    dendritic cell chemotaxis    The movement of a dendritic cell in response to an external stimulus.
    GO:0030260    entry into host cell    The invasion by an organism of a cell of its host organism. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0002064    epithelial cell development    The process whose specific outcome is the progression of an epithelial cell over time, from its formation to the mature structure. An epithelial cell is a cell usually found in a two-dimensional sheet with a free surface.
    GO:0019064    fusion of virus membrane with host plasma membrane    Fusion of a viral membrane with the host cell membrane during viral entry. Results in release of the virion contents into the cytoplasm.
    GO:0006954    inflammatory response    The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
    GO:0043217    myelin maintenance    The process of preserving the structure and function of mature myelin. This includes maintaining the compact structure of myelin necessary for its electrical insulating characteristics as well as the structure of non-compact regions such as Schmidt-Lantermann clefts and paranodal loops. This does not include processes responsible for maintaining the nodes of Ranvier, which are not part of the myelin sheath.
    GO:0001764    neuron migration    The characteristic movement of an immature neuron from germinal zones to specific positions where they will reside as they mature.
    GO:0008038    neuron recognition    The process in which a neuronal cell in a multicellular organism interprets its surroundings.
    GO:0007204    positive regulation of cytosolic calcium ion concentration    Any process that increases the concentration of calcium ions in the cytosol.
    GO:0048714    positive regulation of oligodendrocyte differentiation    Any process that activates or increases the frequency, rate or extent of oligodendrocyte differentiation.
    GO:0051924    regulation of calcium ion transport    Any process that modulates the frequency, rate or extent of the directed movement of calcium ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0030334    regulation of cell migration    Any process that modulates the frequency, rate or extent of cell migration.
    GO:0050920    regulation of chemotaxis    Any process that modulates the frequency, rate or extent of the directed movement of a motile cell or organism in response to a specific chemical concentration gradient.
    GO:0043067    regulation of programmed cell death    Any process that modulates the frequency, rate or extent of programmed cell death, cell death resulting from activation of endogenous cellular processes.
    GO:0001666    response to hypoxia    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
    GO:0009615    response to virus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from a virus.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0022029    telencephalon cell migration    The orderly movement of a cell from one site to another at least one of which is located in the telencephalon.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0030054    cell junction    A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
    GO:0031252    cell leading edge    The area of a motile cell closest to the direction of movement.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0031410    cytoplasmic vesicle    A vesicle found in the cytoplasm of a cell.
    GO:0005769    early endosome    A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
    GO:0005768    endosome    A vacuole to which materials ingested by endocytosis are delivered.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005770    late endosome    A prelysosomal endocytic organelle differentiated from early endosomes by lower lumenal pH and different protein composition. Late endosomes are more spherical than early endosomes and are mostly juxtanuclear, being concentrated near the microtubule organizing center.
    GO:0005764    lysosome    A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ITD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3oe8)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3oe8
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CXCR4_HUMAN | P61073
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  ENLYS_BPT4 | P00720
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.17
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CXCR4_HUMAN | P61073
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ENLYS_BPT4 | P00720
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CXCR4_HUMAN | P610732k03 2k04 2k05 2n55 3odu 3oe0 3oe6 3oe9 4rws
        ENLYS_BPT4 | P00720102l 103l 104l 107l 108l 109l 110l 111l 112l 113l 114l 115l 118l 119l 120l 122l 123l 125l 126l 127l 128l 129l 130l 131l 137l 138l 139l 140l 141l 142l 143l 144l 145l 146l 147l 148l 149l 150l 151l 152l 155l 156l 157l 158l 159l 160l 161l 162l 163l 164l 165l 166l 167l 168l 169l 170l 171l 172l 173l 174l 175l 176l 177l 178l 180l 181l 182l 183l 184l 185l 186l 187l 188l 189l 190l 191l 192l 195l 196l 197l 198l 199l 1b6i 1c60 1c61 1c62 1c63 1c64 1c65 1c66 1c67 1c68 1c69 1c6a 1c6b 1c6c 1c6d 1c6e 1c6f 1c6g 1c6h 1c6i 1c6j 1c6k 1c6l 1c6m 1c6n 1c6p 1c6q 1c6t 1ctw 1cu0 1cu2 1cu3 1cu5 1cu6 1cup 1cuq 1cv0 1cv1 1cv3 1cv4 1cv5 1cv6 1cvk 1cx6 1cx7 1d2w 1d2y 1d3f 1d3j 1d3m 1d3n 1d9w 1dya 1dyb 1dyc 1dyd 1dye 1dyf 1dyg 1epy 1g06 1g07 1g0g 1g0j 1g0k 1g0l 1g0m 1g0p 1g0q 1g1v 1g1w 1i6s 1jqu 1jtm 1jtn 1kni 1ks3 1kw5 1kw7 1ky0 1ky1 1l00 1l01 1l02 1l03 1l04 1l05 1l06 1l07 1l08 1l09 1l0j 1l0k 1l10 1l11 1l12 1l13 1l14 1l15 1l16 1l17 1l18 1l19 1l20 1l21 1l22 1l23 1l24 1l25 1l26 1l27 1l28 1l29 1l30 1l31 1l32 1l33 1l34 1l35 1l36 1l37 1l38 1l39 1l40 1l41 1l42 1l43 1l44 1l45 1l46 1l47 1l48 1l49 1l50 1l51 1l52 1l53 1l54 1l55 1l56 1l57 1l58 1l59 1l60 1l61 1l62 1l63 1l64 1l65 1l66 1l67 1l68 1l69 1l70 1l71 1l72 1l73 1l74 1l75 1l76 1l77 1l79 1l80 1l81 1l82 1l83 1l84 1l85 1l86 1l87 1l88 1l89 1l90 1l91 1l92 1l93 1l94 1l95 1l96 1l97 1l98 1l99 1lgu 1lgw 1lgx 1li2 1li3 1li6 1llh 1lpy 1lw9 1lwg 1lwk 1lyd 1lye 1lyf 1lyg 1lyh 1lyi 1lyj 1nhb 1ov5 1ov7 1ovh 1ovj 1ovk 1owy 1owz 1oyu 1p2l 1p2r 1p36 1p37 1p3n 1p46 1p56 1p5c 1p64 1p6y 1p7s 1pqd 1pqi 1pqj 1pqk 1pqm 1pqo 1qs5 1qs9 1qsb 1qsq 1qt3 1qt4 1qt5 1qt6 1qt7 1qt8 1qtb 1qtc 1qtd 1qth 1qtv 1qtz 1qud 1qug 1quh 1quo 1ssw 1ssy 1swy 1swz 1sx2 1sx7 1t6h 1t8a 1t8f 1t8g 1t97 1tla 1xep 1zur 1zwn 1zyt 200l 201l 205l 206l 209l 210l 211l 212l 213l 214l 215l 216l 217l 218l 219l 220l 221l 222l 223l 224l 225l 226l 227l 228l 229l 230l 231l 232l 233l 234l 235l 236l 237l 238l 239l 240l 241l 242l 243l 244l 245l 246l 247l 248l 249l 250l 251l 252l 253l 254l 255l 256l 257l 258l 259l 260l 261l 262l 2a4t 2b6t 2b6w 2b6x 2b6y 2b6z 2b70 2b72 2b73 2b74 2b75 2b7x 2cuu 2f2q 2f32 2f47 2huk 2hul 2hum 2igc 2l78 2lc9 2lcb 2lzm 2ntg 2nth 2o4w 2o79 2o7a 2oe4 2oe7 2oe9 2oea 2oty 2otz 2ou0 2ou8 2ou9 2q9d 2q9e 2qar 2qb0 2ray 2raz 2rb0 2rb1 2rb2 2rbn 2rbo 2rbp 2rbq 2rbr 2rbs 2rh1 3c7w 3c7y 3c7z 3c80 3c81 3c82 3c83 3c8q 3c8r 3c8s 3cdo 3cdq 3cdr 3cdt 3cdv 3d4s 3dke 3dmv 3dmx 3dmz 3dn0 3dn1 3dn2 3dn3 3dn4 3dn6 3dn8 3dna 3eml 3f8v 3f9l 3fa0 3fad 3fi5 3g3v 3g3w 3g3x 3gui 3guj 3guk 3gul 3gum 3gun 3guo 3gup 3hh3 3hh4 3hh5 3hh6 3ht6 3ht7 3ht8 3ht9 3htb 3htd 3htf 3htg 3hu8 3hu9 3hua 3huk 3huq 3hwl 3jr6 3k2r 3l2x 3l64 3lzm 3ny8 3ny9 3nya 3odu 3oe0 3oe6 3oe9 3p0g 3pbl 3pds 3qak 3run 3rze 3sb5 3sb6 3sb7 3sb8 3sb9 3sba 3sbb 3sn6 3uon 3v2w 3v2y 3vw7 4arj 4daj 4djh 4dkl 4e97 4ej4 4ekp 4ekq 4ekr 4eks 4epi 4exm 4gbr 4grv 4htt 4i7j 4i7k 4i7l 4i7m 4i7n 4i7o 4i7p 4i7q 4i7r 4i7s 4i7t 4iap 4k5y 4lde 4ldl 4ldo 4lzm 4n9n 4oo9 4phu 4rws 4s0w 4tn3 4u14 4w51 4w52 4w53 4w54 4w55 4w56 4w57 4w58 4w59 4w8f 4wtv 4xee 4xes 4yx7 4yxa 4yxc 4zwj 5b2g 5cgc 5cgd 5cxv 5d5a 5d5b 5d6l 5dgy 5dsg 5ee7 5eut 5ewx 5g27 5glh 5gli 5i14 5jdt 5jea 5jgn 5jgr 5jgu 5jgv 5jgx 5jgz 5jqh 5jws 5jwt 5jwu 5jwv 5jww 5kgr 5khz 5ki1 5ki2 5ki3 5ki8 5kig 5kii 5kim 5kio 5lwo 5lzm 5t04 5t1a 5tzr 5tzy 5vew 5vex 6lzm 7lzm

(-) Related Entries Specified in the PDB File

3odu SAME PROTEIN AT 2.5 A IN P21 SPACEGROUP
3oe0 SAME PROTEIN IN COMPLEX WITH A CYCLIC PEPTIDE CVX15
3oe6 SAME PROTEIN IN I222 SPACEGROUP
3oe9 SAME PROTEIN IN P1 SPACEGROUP WITH 2 MOLECULES PER ASYMMETRIC UNIT RELATED ID: GPCR-34 RELATED DB: TARGETTRACK