3UVL - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF WDR5 IN COMPLEX WITH THE WDR5-INTERACTING MOTIF OF MLL3

Authors :   P. Zhang, H. Lee, J. S. Brunzelle, J. -F. Couture

Date :   30 Nov 11 (Deposition) - 14 Dec 11 (Release) - 30 May 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym./Biol. Unit : A,B

Keywords :   Trithorax, Chromatin Biology, Beta-Propeller, Scaffolding, Histone H3, Nucleus, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. Zhang, H. Lee, J. S. Brunzelle, J. F. Couture
The Plasticity Of Wdr5 Peptide-Binding Cleft Enables The Binding Of The Set1 Family Of Histone Methyltransferases.
Nucleic Acids Res. V. 40 4237 2012
PubMed-ID: 22266653 | Reference-DOI: 10.1093/NAR/GKR1235

Molecule 1 - WD REPEAT-CONTAINING PROTEIN 5
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	UNP RESIDUES 21-334
	Gene	:	WDR5, BIG3
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	WDR5, BMP2-INDUCED 3-KB GENE PROTEIN

Molecule 2 - HISTONE-LYSINE N-METHYLTRANSFERASE MLL3
	Chains	:	B
	EC Number	:	2.1.1.43
	Engineered	:	YES
	Fragment	:	WDR5-INTERACTING MOTIF (UNP RESIDUES 4707-4717)
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	HOMOLOGOUS TO ALR PROTEIN, LYSINE N-METHYLTRANSFERASE 2C, KMT2C, MYELOID/LYMPHOID OR MIXED-LINEAGE LEUKEMIA PROTEIN 3
	Synthetic	:	YES

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 3UVL)

(no "Site" information available for 3UVL)

(no "SS Bond" information available for 3UVL)

(no "Cis Peptide Bond" information available for 3UVL)

(no "SAP(SNP)/Variant" information available for 3UVL)

Asymmetric/Biological Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	WD_REPEATS_1	PS00678	Trp-Asp (WD) repeats signature.	WDR5_HUMAN	102-116 144-158 186-200 274-288	4	A:102-116 A:144-158 A:186-200 A:274-288

Asymmetric/Biological Unit (13, 13)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2a	ENST00000355193	2a	ENSE00001642231	chr7:152133090-152132711	380	KMT2C_HUMAN	1-54	54	0	-	-
1.3	ENST00000355193	3	ENSE00001779646	chr7:152055760-152055672	89	KMT2C_HUMAN	54-84	31	0	-	-
1.5c	ENST00000355193	5c	ENSE00001596960	chr7:152027824-152027686	139	KMT2C_HUMAN	84-130	47	0	-	-
1.6b	ENST00000355193	6b	ENSE00001774010	chr7:152012423-152012223	201	KMT2C_HUMAN	130-197	68	0	-	-
1.7b	ENST00000355193	7b	ENSE00001749065	chr7:152009031-152008883	149	KMT2C_HUMAN	197-247	51	0	-	-
1.8a	ENST00000355193	8a	ENSE00001803163	chr7:152007160-152007051	110	KMT2C_HUMAN	247-283	37	0	-	-
1.9	ENST00000355193	9	ENSE00001783379	chr7:151970952-151970790	163	KMT2C_HUMAN	284-338	55	0	-	-
1.10	ENST00000355193	10	ENSE00001799851	chr7:151962294-151962123	172	KMT2C_HUMAN	338-395	58	0	-	-
1.11	ENST00000355193	11	ENSE00001721204	chr7:151960215-151960101	115	KMT2C_HUMAN	395-433	39	0	-	-
1.12	ENST00000355193	12	ENSE00001629216	chr7:151949800-151949631	170	KMT2C_HUMAN	434-490	57	0	-	-
1.13	ENST00000355193	13	ENSE00001666640	chr7:151949175-151949024	152	KMT2C_HUMAN	490-541	52	0	-	-
1.14	ENST00000355193	14	ENSE00001791110	chr7:151948051-151947938	114	KMT2C_HUMAN	541-579	39	0	-	-
1.15	ENST00000355193	15	ENSE00001635330	chr7:151947038-151946961	78	KMT2C_HUMAN	579-605	27	0	-	-
1.16a	ENST00000355193	16a	ENSE00001712229	chr7:151945705-151944987	719	KMT2C_HUMAN	605-844	240	0	-	-
1.17b	ENST00000355193	17b	ENSE00001613372	chr7:151935911-151935792	120	KMT2C_HUMAN	845-884	40	0	-	-
1.19	ENST00000355193	19	ENSE00001619203	chr7:151933018-151932902	117	KMT2C_HUMAN	885-923	39	0	-	-
1.20	ENST00000355193	20	ENSE00001758947	chr7:151927406-151927305	102	KMT2C_HUMAN	924-957	34	0	-	-
1.21b	ENST00000355193	21b	ENSE00001726293	chr7:151927112-151927008	105	KMT2C_HUMAN	958-992	35	0	-	-
1.22	ENST00000355193	22	ENSE00000730374	chr7:151921701-151921520	182	KMT2C_HUMAN	993-1053	61	0	-	-
1.23b	ENST00000355193	23b	ENSE00001630291	chr7:151921264-151921100	165	KMT2C_HUMAN	1053-1108	56	0	-	-
1.25	ENST00000355193	25	ENSE00001754170	chr7:151919767-151919658	110	KMT2C_HUMAN	1108-1145	38	0	-	-
1.26c	ENST00000355193	26c	ENSE00000730386	chr7:151919151-151919086	66	KMT2C_HUMAN	1145-1167	23	0	-	-
1.27a	ENST00000355193	27a	ENSE00001628944	chr7:151917820-151917608	213	KMT2C_HUMAN	1167-1238	72	0	-	-
1.28	ENST00000355193	28	ENSE00000730393	chr7:151904513-151904385	129	KMT2C_HUMAN	1238-1281	44	0	-	-
1.29	ENST00000355193	29	ENSE00000730396	chr7:151902310-151902191	120	KMT2C_HUMAN	1281-1321	41	0	-	-
1.30	ENST00000355193	30	ENSE00000430342	chr7:151900149-151900019	131	KMT2C_HUMAN	1321-1364	44	0	-	-
1.31	ENST00000355193	31	ENSE00000730402	chr7:151896544-151896364	181	KMT2C_HUMAN	1365-1425	61	0	-	-
1.32	ENST00000355193	32	ENSE00000730404	chr7:151893096-151892992	105	KMT2C_HUMAN	1425-1460	36	0	-	-
1.33	ENST00000355193	33	ENSE00000730409	chr7:151891653-151891525	129	KMT2C_HUMAN	1460-1503	44	0	-	-
1.34	ENST00000355193	34	ENSE00000730414	chr7:151891346-151891314	33	KMT2C_HUMAN	1503-1514	12	0	-	-
1.35	ENST00000355193	35	ENSE00000730416	chr7:151891213-151891094	120	KMT2C_HUMAN	1514-1554	41	0	-	-
1.36	ENST00000355193	36	ENSE00000430344	chr7:151884932-151884800	133	KMT2C_HUMAN	1554-1598	45	0	-	-
1.37	ENST00000355193	37	ENSE00000730421	chr7:151884561-151884347	215	KMT2C_HUMAN	1598-1670	73	0	-	-
1.38	ENST00000355193	38	ENSE00000730423	chr7:151882716-151882643	74	KMT2C_HUMAN	1670-1694	25	0	-	-
1.39	ENST00000355193	39	ENSE00000730426	chr7:151880241-151880059	183	KMT2C_HUMAN	1695-1755	61	0	-	-
1.40	ENST00000355193	40	ENSE00000730429	chr7:151879679-151877796	1884	KMT2C_HUMAN	1756-2383	628	0	-	-
1.41	ENST00000355193	41	ENSE00000730434	chr7:151877211-151876919	293	KMT2C_HUMAN	2384-2481	98	0	-	-
1.42a	ENST00000355193	42a	ENSE00000730439	chr7:151875095-151873276	1820	KMT2C_HUMAN	2481-3088	608	0	-	-
1.43	ENST00000355193	43	ENSE00000730441	chr7:151871327-151871216	112	KMT2C_HUMAN	3088-3125	38	0	-	-
1.44	ENST00000355193	44	ENSE00000730442	chr7:151868427-151868349	79	KMT2C_HUMAN	3125-3151	27	0	-	-
1.45	ENST00000355193	45	ENSE00000430311	chr7:151866334-151866271	64	KMT2C_HUMAN	3152-3173	22	0	-	-
1.46	ENST00000355193	46	ENSE00000730443	chr7:151864463-151864231	233	KMT2C_HUMAN	3173-3250	78	0	-	-
1.47a	ENST00000355193	47a	ENSE00000730444	chr7:151860911-151859202	1710	KMT2C_HUMAN	3251-3820	570	0	-	-
1.48b	ENST00000355193	48b	ENSE00000730447	chr7:151856157-151855942	216	KMT2C_HUMAN	3821-3892	72	0	-	-
1.49	ENST00000355193	49	ENSE00000730450	chr7:151855010-151854846	165	KMT2C_HUMAN	3893-3947	55	0	-	-
1.50a	ENST00000355193	50a	ENSE00000730453	chr7:151853431-151853290	142	KMT2C_HUMAN	3948-3995	48	0	-	-
1.51	ENST00000355193	51	ENSE00000730457	chr7:151853142-151852995	148	KMT2C_HUMAN	3995-4044	50	0	-	-
1.53	ENST00000355193	53	ENSE00000730460	chr7:151851530-151851352	179	KMT2C_HUMAN	4044-4104	61	0	-	-
1.54	ENST00000355193	54	ENSE00000730462	chr7:151851231-151851095	137	KMT2C_HUMAN	4104-4149	46	0	-	-
1.55c	ENST00000355193	55c	ENSE00000430326	chr7:151850039-151849790	250	KMT2C_HUMAN	4150-4233	84	0	-	-
1.56	ENST00000355193	56	ENSE00000730467	chr7:151848666-151848527	140	KMT2C_HUMAN	4233-4279	47	0	-	-
1.57	ENST00000355193	57	ENSE00000730470	chr7:151848092-151847985	108	KMT2C_HUMAN	4280-4315	36	0	-	-
1.58	ENST00000355193	58	ENSE00000730472	chr7:151846237-151845118	1120	KMT2C_HUMAN	4316-4689	374	0	-	-
1.59	ENST00000355193	59	ENSE00000730474	chr7:151843820-151843684	137	KMT2C_HUMAN	4689-4734	46	1	B:3762-3770	9
1.60b	ENST00000355193	60b	ENSE00000730475	chr7:151842380-151842238	143	KMT2C_HUMAN	4735-4782	48	0	-	-
1.61	ENST00000355193	61	ENSE00000730477	chr7:151841966-151841798	169	KMT2C_HUMAN	4782-4838	57	0	-	-
1.63b	ENST00000355193	63b	ENSE00000730479	chr7:151836876-151836760	117	KMT2C_HUMAN	4839-4877	39	0	-	-
1.64	ENST00000355193	64	ENSE00000730480	chr7:151836344-151836271	74	KMT2C_HUMAN	4878-4902	25	0	-	-
1.65a	ENST00000355193	65a	ENSE00000730481	chr7:151835989-151835881	109	KMT2C_HUMAN	4902-4938	37	0	-	-
1.65e	ENST00000355193	65e	ENSE00001424024	chr7:151834009-151832014	1996	KMT2C_HUMAN	4939-4968	30	0	-	-

2.1	ENST00000358625	1	ENSE00001422154	chr9:137001210-137001322	113	WDR5_HUMAN	-	0	0	-	-
2.2b	ENST00000358625	2b	ENSE00001399325	chr9:137004942-137005080	139	WDR5_HUMAN	1-27	27	0	-	-
2.3	ENST00000358625	3	ENSE00001378987	chr9:137005825-137005933	109	WDR5_HUMAN	28-64	37	1	A:31-64	34
2.4	ENST00000358625	4	ENSE00001370072	chr9:137006632-137006705	74	WDR5_HUMAN	64-88	25	1	A:64-88	25
2.5	ENST00000358625	5	ENSE00001422107	chr9:137007071-137007160	90	WDR5_HUMAN	89-118	30	1	A:89-118	30
2.6	ENST00000358625	6	ENSE00001415339	chr9:137007455-137007544	90	WDR5_HUMAN	119-148	30	1	A:119-148	30
2.7	ENST00000358625	7	ENSE00001416091	chr9:137007758-137007841	84	WDR5_HUMAN	149-176	28	1	A:149-176	28
2.8	ENST00000358625	8	ENSE00001401373	chr9:137013410-137013465	56	WDR5_HUMAN	177-195	19	1	A:177-195	19
2.9	ENST00000358625	9	ENSE00001430459	chr9:137017105-137017151	47	WDR5_HUMAN	195-211	17	1	A:195-210	16
2.10	ENST00000358625	10	ENSE00001411527	chr9:137019588-137019663	76	WDR5_HUMAN	211-236	26	1	A:212-236	25
2.11	ENST00000358625	11	ENSE00001429531	chr9:137020462-137020495	34	WDR5_HUMAN	236-247	12	1	A:236-247	12
2.12	ENST00000358625	12	ENSE00001431152	chr9:137020815-137020889	75	WDR5_HUMAN	248-272	25	1	A:248-272	25
2.13	ENST00000358625	13	ENSE00001417345	chr9:137021628-137021715	88	WDR5_HUMAN	273-302	30	1	A:273-302	30
2.14a	ENST00000358625	14a	ENSE00001833493	chr9:137023015-137025090	2076	WDR5_HUMAN	302-334	33	1	A:302-334	33

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:303
 aligned with WDR5_HUMAN | P61964 from UniProtKB/Swiss-Prot  Length:334

    Alignment length:304
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330    
          WDR5_HUMAN     31 VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC  334
               SCOP domains d3uvla_ A: automated matches                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeee......eeeeee.....eeeeee....eeeee.....eeeee......eeeeee.....eeeeee...eeeeee.....eeeeee.....eeeeee.....eeeeee....eeeee.....eeeee......eeeeee.....eeeeee....eeeee.....eeeee.-.....eeeeee.....eeeeee...eeeeee....eeeeee...........eeee.....eeee......eeeee.....eeeee......eeeeee.....eeeeee......eeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------WD_REPEATS_1   ---------------------------WD_REPEATS_1   ---------------------------WD_REPEATS_1   -------------------------------------------------------------------------WD_REPEATS_1   ---------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.3  PDB: A:31-64            ------------------------Exon 2.5  PDB: A:89-118       Exon 2.6  PDB: A:119-148      Exon 2.7  PDB: A:149-176    Exon 2.8           ---------------Exon 2.10  PDB: A:212-236 -----------Exon 2.12  PDB: A:248-272Exon 2.13  PDB: A:273-302     -------------------------------- Transcript 2 (1)
           Transcript 2 (2) ---------------------------------Exon 2.4  PDB: A:64-88   ----------------------------------------------------------------------------------------------------------Exon 2.9         ------------------------Exon 2.11   ------------------------------------------------------Exon 2.14a  PDB: A:302-334        Transcript 2 (2)
                3uvl A   31 VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLI-DDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC  334
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210 |     220       230       240       250       260       270       280       290       300       310       320       330    
                                                                                                                                                                                                             210 |                                                                                                                          
                                                                                                                                                                                                               212

Chain B from PDB  Type:PROTEIN  Length:9
 aligned with KMT2C_HUMAN | Q8NEZ4 from UniProtKB/Swiss-Prot  Length:4911

    Alignment length:9
         KMT2C_HUMAN   4707 GCARSEPKM 4715
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author .hhhhh... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
               Transcript 1 Exon 1.59 Transcript 1
                3uvl B 3762 GSARAEPKM 3770

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: 7-bladed beta-propeller (245)

Superfamily: WD40 repeat-like (95)

Family: automated matches (36)

Protein domain: automated matches (36)

Human (Homo sapiens) [TaxId: 9606] (34)

d3uvla_

(no "CATH Domain" information available for 3UVL)

(no "Pfam Domain" information available for 3UVL)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (WDR5_HUMAN | P61964)

molecular function
	GO:0046972	histone acetyltransferase activity (H4-K16 specific)	Catalysis of the reaction: acetyl-CoA + histone H4 L-lysine (position 16) = CoA + histone H4 N6-acetyl-L-lysine (position 16). This reaction represents the addition of an acetyl group to the lysine at position 16 of histone H4.
	GO:0043995	histone acetyltransferase activity (H4-K5 specific)	Catalysis of the reaction: acetyl-CoA + histone H4 L-lysine (position 5) = CoA + histone H4 N6-acetyl-L-lysine (position 5).
	GO:0043996	histone acetyltransferase activity (H4-K8 specific)	Catalysis of the reaction: acetyl-CoA + histone H4 L-lysine (position 8) = CoA + histone H4 N6-acetyl-L-lysine (position 8).
	GO:0042800	histone methyltransferase activity (H3-K4 specific)	Catalysis of the reaction: S-adenosyl-L-methionine + histone H3 L-lysine (position 4) = S-adenosyl-L-homocysteine + histone H3 N6-methyl-L-lysine (position 4). This reaction is the addition of a methyl group onto lysine at position 4 of the histone H3 protein.
	GO:0018024	histone-lysine N-methyltransferase activity	Catalysis of the reaction: S-adenosyl-L-methionine + histone L-lysine = S-adenosyl-L-homocysteine + histone N6-methyl-L-lysine. The methylation of peptidyl-lysine in histones forms N6-methyl-L-lysine, N6,N6-dimethyl-L-lysine and N6,N6,N6-trimethyl-L-lysine derivatives.
	GO:0035064	methylated histone binding	Interacting selectively and non-covalently with a histone in which a residue has been modified by methylation. Histones are any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0043966	histone H3 acetylation	The modification of histone H3 by the addition of an acetyl group.
	GO:0051568	histone H3-K4 methylation	The modification of histone H3 by addition of one or more methyl groups to lysine at position 4 of the histone.
	GO:0043984	histone H4-K16 acetylation	The modification of histone H4 by the addition of an acetyl group to a lysine residue at position 16 of the histone.
	GO:0043981	histone H4-K5 acetylation	The modification of histone H4 by the addition of an acetyl group to a lysine residue at position 5 of the histone.
	GO:0043982	histone H4-K8 acetylation	The modification of histone H4 by the addition of an acetyl group to a lysine residue at position 8 of the histone.
	GO:0031175	neuron projection development	The process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
	GO:0035948	positive regulation of gluconeogenesis by positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of gluconeogenesis by activating or increasing the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0001501	skeletal system development	The process whose specific outcome is the progression of the skeleton over time, from its formation to the mature structure. The skeleton is the bony framework of the body in vertebrates (endoskeleton) or the hard outer envelope of insects (exoskeleton or dermoskeleton).
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	A multiprotein complex that possesses histone acetyltransferase and is involved in regulation of transcription. Contains either GCN5 or PCAF in a mutually exclusive manner. The budding yeast complex includes Gcn5p, two proteins of the Ada family, and two TBP-associate proteins (TAFs); analogous complexes in other species have analogous compositions, and usually contain homologs of the yeast proteins. Both ATAC- or SAGA (see GO:0000124, SAGA complex) are involved in the acetylation of histone H3K9 and K14 residues.
	GO:0071339	MLL1 complex	A protein complex that can methylate lysine-4 of histone H3. MLL1/MLL is the catalytic methyltransferase subunit, and the complex also contains the core components ASH2L, HCFC1/HCF1 WDR5 and RBBP5.
	GO:0044666	MLL3/4 complex	A protein complex that can methylate lysine-4 of histone H3, and which contains either of the protein subunits MLL3 or MLL4 in mammals, or equivalent in other species.
	GO:0048188	Set1C/COMPASS complex	A conserved protein complex that catalyzes methylation of histone H3. In Saccharomyces the complex contains Shg1p, Sdc1p, Swd1p, Swd2p, Swd3p, Spp1p, Bre2p, and the trithorax-related Set1p; in mammals it contains the catalytic subunit (SETD1A or SETD1B), WDR5, WDR82, RBBP5, ASH2L/ASH2, CXXC1/CFP1, HCFC1 and DPY30.
	GO:0000123	histone acetyltransferase complex	A protein complex that possesses histone acetyltransferase activity.
	GO:0035097	histone methyltransferase complex	A multimeric complex that is able to catalyze the addition of methyl groups to histone proteins.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B (KMT2C_HUMAN | Q8NEZ4)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0042800	histone methyltransferase activity (H3-K4 specific)	Catalysis of the reaction: S-adenosyl-L-methionine + histone H3 L-lysine (position 4) = S-adenosyl-L-homocysteine + histone H3 N6-methyl-L-lysine (position 4). This reaction is the addition of a methyl group onto lysine at position 4 of the histone H3 protein.
	GO:0018024	histone-lysine N-methyltransferase activity	Catalysis of the reaction: S-adenosyl-L-methionine + histone L-lysine = S-adenosyl-L-homocysteine + histone N6-methyl-L-lysine. The methylation of peptidyl-lysine in histones forms N6-methyl-L-lysine, N6,N6-dimethyl-L-lysine and N6,N6,N6-trimethyl-L-lysine derivatives.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0008168	methyltransferase activity	Catalysis of the transfer of a methyl group to an acceptor molecule.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0051568	histone H3-K4 methylation	The modification of histone H3 by addition of one or more methyl groups to lysine at position 4 of the histone.
	GO:0034968	histone lysine methylation	The modification of a histone by addition of one or more methyl groups to a lysine residue.
	GO:0032259	methylation	The process in which a methyl group is covalently attached to a molecule.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0044666	MLL3/4 complex	A protein complex that can methylate lysine-4 of histone H3, and which contains either of the protein subunits MLL3 or MLL4 in mammals, or equivalent in other species.
	GO:0035097	histone methyltransferase complex	A multimeric complex that is able to catalyze the addition of methyl groups to histone proteins.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3uvl)

	Sites
(no "Sites" information available for 3uvl)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3uvl)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3uvl
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	KMT2C_HUMAN \| Q8NEZ4
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	WDR5_HUMAN \| P61964
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.1.1.43
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	KMT2C_HUMAN \| Q8NEZ4
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	WDR5_HUMAN \| P61964
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

3uvk	CRYSTAL STRUCTURE OF WDR5 IN COMPLEX WITH THE WDR5- INTERACTING MOTIF OF MLL2
3uvm	CRYSTAL STRUCTURE OF WDR5 IN COMPLEX WITH THE WDR5- INTERACTING MOTIF OF MLL4
3uvn	CRYSTAL STRUCTURE OF WDR5 IN COMPLEX WITH THE WDR5- INTERACTING MOTIF OF SET1A
3uvo	CRYSTAL STRUCTURE OF WDR5 IN COMPLEX WITH THE WDR5- INTERACTING MOTIF OF SET1B

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (13, 13)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (33, 43)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File