3RW7 - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   STRUCTURE OF N-TERMINAL DOMAIN OF NUCLEAR RNA EXPORT FACTOR TAP

Authors :   M. Teplova, N. W. Khin, L. Wohlbold, E. Izaurralde, D. J. Patel

Date :   07 May 11 (Deposition) - 10 Aug 11 (Release) - 02 Nov 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.00

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Rna Recognition Motif (Rrm), Leucine-Rich Repeat (Lrr) Motif, Rna Binding Protein, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Teplova, L. Wohlbold, N. W. Khin, E. Izaurralde, D. J. Patel
Structure-Function Studies Of Nucleocytoplasmic Transport O Retroviral Genomic Rna By Mrna Export Factor Tap.
Nat. Struct. Mol. Biol. V. 18 990 2011
PubMed-ID: 21822283 | Reference-DOI: 10.1038/NSMB.2094

Molecule 1 - NUCLEAR RNA EXPORT FACTOR 1
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	T7
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	RRM-LRR DOMAINS, UNP RESIDUES 96-362
	Gene	:	NXF1, TAP, TAP (NXF1)
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TIP-ASSOCIATED PROTEIN, TIP-ASSOCIATING PROTEIN, MRNA EXPORT FACTOR TAP

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 3RW7)

(no "Site" information available for 3RW7)

(no "SS Bond" information available for 3RW7)

(no "Cis Peptide Bond" information available for 3RW7)

(no "SAP(SNP)/Variant" information available for 3RW7)

Asymmetric Unit (1, 12)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LRR	PS51450	Leucine-rich repeat profile.	NXF1_HUMAN	266-287 292-313 316-337	12	A:266-287 B:266-287 C:266-287 D:266-287 A:292-313 B:292-313 C:292-313 D:292-313 A:316-337 B:316-337 C:316-337 D:316-337

Biological Unit 1 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LRR	PS51450	Leucine-rich repeat profile.	NXF1_HUMAN	266-287 292-313 316-337	3	A:266-287 - - - A:292-313 - - - A:316-337 - - -

Biological Unit 2 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LRR	PS51450	Leucine-rich repeat profile.	NXF1_HUMAN	266-287 292-313 316-337	3	- B:266-287 - - - B:292-313 - - - B:316-337 - -

Biological Unit 3 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LRR	PS51450	Leucine-rich repeat profile.	NXF1_HUMAN	266-287 292-313 316-337	3	- - C:266-287 - - - C:292-313 - - - C:316-337 -

Biological Unit 4 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LRR	PS51450	Leucine-rich repeat profile.	NXF1_HUMAN	266-287 292-313 316-337	3	- - - D:266-287 - - - D:292-313 - - - D:316-337

Asymmetric Unit (10, 34)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2b	ENST00000294172	2b	ENSE00001198395	chr11:62572964-62572801	164	NXF1_HUMAN	1-10	10	0	-	-
1.4e	ENST00000294172	4e	ENSE00001063544	chr11:62571450-62571264	187	NXF1_HUMAN	10-72	63	0	-	-
1.4g	ENST00000294172	4g	ENSE00001198378	chr11:62571044-62570891	154	NXF1_HUMAN	72-123	52	2	A:118-123 - C:117-123 -	6 - 7 -
1.5b	ENST00000294172	5b	ENSE00001198363	chr11:62569732-62569649	84	NXF1_HUMAN	124-151	28	2	A:124-151 - C:124-151 -	28 - 28 -
1.6c	ENST00000294172	6c	ENSE00001198351	chr11:62569518-62569414	105	NXF1_HUMAN	152-186	35	2	A:152-186 - C:152-186 -	35 - 35 -
1.7	ENST00000294172	7	ENSE00001198338	chr11:62569291-62569211	81	NXF1_HUMAN	187-213	27	4	A:187-213 (gaps) B:203-213 C:187-213 (gaps) D:204-213	27 11 27 10
1.8	ENST00000294172	8	ENSE00001198325	chr11:62569103-62569034	70	NXF1_HUMAN	214-237	24	4	A:214-237 B:214-237 C:214-237 D:214-237	24 24 24 24
1.9	ENST00000294172	9	ENSE00001198312	chr11:62568889-62568801	89	NXF1_HUMAN	237-266	30	4	A:237-266 B:237-266 C:237-266 D:237-266	30 30 30 30
1.10	ENST00000294172	10	ENSE00001198304	chr11:62568673-62568566	108	NXF1_HUMAN	267-302	36	4	A:267-302 B:267-302 C:267-302 D:267-302	36 36 36 36
1.11a	ENST00000294172	11a	ENSE00001198291	chr11:62567958-62567849	110	NXF1_HUMAN	303-339	37	4	A:303-339 B:303-339 C:303-339 D:303-339	37 37 37 37
1.11g	ENST00000294172	11g	ENSE00001198284	chr11:62566047-62566011	37	NXF1_HUMAN	339-351	13	4	A:339-351 B:339-351 C:339-351 D:339-351	13 13 13 13
1.12	ENST00000294172	12	ENSE00001063548	chr11:62564858-62564790	69	NXF1_HUMAN	352-374	23	4	A:352-362 B:352-362 C:352-362 D:352-362	11 11 11 11
1.13	ENST00000294172	13	ENSE00001063546	chr11:62564710-62564655	56	NXF1_HUMAN	375-393	19	0	-	-
1.15a	ENST00000294172	15a	ENSE00001063554	chr11:62564039-62563932	108	NXF1_HUMAN	393-429	37	0	-	-
1.16b	ENST00000294172	16b	ENSE00001141830	chr11:62563817-62563759	59	NXF1_HUMAN	429-449	21	0	-	-
1.17b	ENST00000294172	17b	ENSE00001141824	chr11:62563653-62563538	116	NXF1_HUMAN	449-487	39	0	-	-
1.18	ENST00000294172	18	ENSE00001141816	chr11:62563415-62563373	43	NXF1_HUMAN	488-502	15	0	-	-
1.19b	ENST00000294172	19b	ENSE00001274696	chr11:62562479-62562407	73	NXF1_HUMAN	502-526	25	0	-	-
1.20c	ENST00000294172	20c	ENSE00001063547	chr11:62561912-62561730	183	NXF1_HUMAN	526-587	62	0	-	-
1.21a	ENST00000294172	21a	ENSE00001764908	chr11:62560173-62560113	61	NXF1_HUMAN	587-607	21	0	-	-
1.21h	ENST00000294172	21h	ENSE00001198195	chr11:62559986-62559598	389	NXF1_HUMAN	608-619	12	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:242
 aligned with NXF1_HUMAN | Q9UBU9 from UniProtKB/Swiss-Prot  Length:619

    Alignment length:245
                                   127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357     
           NXF1_HUMAN   118 NWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF 362
               SCOP domains d3rw7a1 A:118-199 automated matches                                               ---d3rw7a2 A:203-362 automated matches                                                                                                                              SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhhhhhhhhhhhhhhh......eeeeee..eeeeee.hhhhhhhhhh...............eeeee.....---..hhhhhhhhhhhhhhhee....eee......hhhhhh........hhhhhhhhhhhhhhhh....eee.......hhhhhhhhhhhh....eee........hhhhhhh......eee...........hhhhhhhhhhh......ee..ee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------LRR  PDB: A:266-287   ----LRR  PDB: A:292-313   --LRR  PDB: A:316-337   ------------------------- PROSITE
           Transcript 1 (1) 1.4g  Exon 1.5b  PDB: A:124-151   Exon 1.6c  PDB: A:152-186          Exon 1.7 UniProt: 187-213  Exon 1.8  PDB: A:214-237-----------------------------Exon 1.10  PDB: A:267-302           Exon 1.11a  PDB: A:303-339           ------------Exon 1.12   Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------Exon 1.9  PDB: A:237-266      ------------------------------------------------------------------------Exon 1.11g   ----------- Transcript 1 (2)
                 3rw7 A 118 NWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHT---ELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF 362
                                   127       137       147       157       167       177       187       197 |   | 207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357     
                                                                                                           199 203

Chain B from PDB  Type:PROTEIN  Length:160
 aligned with NXF1_HUMAN | Q9UBU9 from UniProtKB/Swiss-Prot  Length:619

    Alignment length:160
                                   212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362
           NXF1_HUMAN   203 ELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF 362
               SCOP domains d3rw7b_ B: automated matches                                                                                                                                     SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhee....eee..hhhhhhhhhh........hhhhhhhhhhhhhhhh....eee.......hhhhhhhhhhhh....eee.......hhhhhhhhh.....eee...hhhhhhh.hhhhhhhhhhh......ee..ee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------LRR  PDB: B:266-287   ----LRR  PDB: B:292-313   --LRR  PDB: B:316-337   ------------------------- PROSITE
           Transcript 1 (1) Exon 1.7   Exon 1.8  PDB: B:214-237-----------------------------Exon 1.10  PDB: B:267-302           Exon 1.11a  PDB: B:303-339           ------------Exon 1.12   Transcript 1 (1)
           Transcript 1 (2) ----------------------------------Exon 1.9  PDB: B:237-266      ------------------------------------------------------------------------Exon 1.11g   ----------- Transcript 1 (2)
                 3rw7 B 203 ELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF 362
                                   212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362

Chain C from PDB  Type:PROTEIN  Length:242
 aligned with NXF1_HUMAN | Q9UBU9 from UniProtKB/Swiss-Prot  Length:619

    Alignment length:246
                                   126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356      
           NXF1_HUMAN   117 KNWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF 362
               SCOP domains d3rw7c1 C:117-198 automated matches                                               ----d3rw7c2 C:203-362 automated matches                                                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee.hhhhhhhhhhhhhhhh........eeeeee..eeeeee...hhhhhhhhh..............eeeee....----..hhhhhhhhhhhhhhhee....eee..hhhhhhhhhhhh......hhhhhhhhhhhhhhhh....eee.......hhhhhhhhhhhh....eee.......hhhhhhhhh.....eee...hhhhh...hhhhhhhhhhhhh....ee..ee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------LRR  PDB: C:266-287   ----LRR  PDB: C:292-313   --LRR  PDB: C:316-337   ------------------------- PROSITE
           Transcript 1 (1) 1.4g   Exon 1.5b  PDB: C:124-151   Exon 1.6c  PDB: C:152-186          Exon 1.7 UniProt: 187-213  Exon 1.8  PDB: C:214-237-----------------------------Exon 1.10  PDB: C:267-302           Exon 1.11a  PDB: C:303-339           ------------Exon 1.12   Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------Exon 1.9  PDB: C:237-266      ------------------------------------------------------------------------Exon 1.11g   ----------- Transcript 1 (2)
                 3rw7 C 117 KNWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPH----ELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF 362
                                   126       136       146       156       166       176       186       196 |    |206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356      
                                                                                                           198  203

Chain D from PDB  Type:PROTEIN  Length:159
 aligned with NXF1_HUMAN | Q9UBU9 from UniProtKB/Swiss-Prot  Length:619

    Alignment length:159
                                   213       223       233       243       253       263       273       283       293       303       313       323       333       343       353         
           NXF1_HUMAN   204 LKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF 362
               SCOP domains d3rw7d_ D: automated matches                                                                                                                                    SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhh.ee....eee......hhhhhh........hhhhhhhhhhhhhhhh....eee.......hhhhhhhhhhh.....eee.......hhhhhhhhh.....eee...hhhhhhh.hhhhhhhhhhhhh....ee..ee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------LRR  PDB: D:266-287   ----LRR  PDB: D:292-313   --LRR  PDB: D:316-337   ------------------------- PROSITE
           Transcript 1 (1) Exon 1.7  Exon 1.8  PDB: D:214-237-----------------------------Exon 1.10  PDB: D:267-302           Exon 1.11a  PDB: D:303-339           ------------Exon 1.12   Transcript 1 (1)
           Transcript 1 (2) ---------------------------------Exon 1.9  PDB: D:237-266      ------------------------------------------------------------------------Exon 1.11g   ----------- Transcript 1 (2)
                 3rw7 D 204 LKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF 362
                                   213       223       233       243       253       263       273       283       293       303       313       323       333       343       353

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Ferredoxin-like (1795)

Superfamily: RNA-binding domain, RBD (289)

Family: automated matches (67)

Protein domain: automated matches (67)

Human (Homo sapiens) [TaxId: 9606] (56)

1a	d3rw7a1	A:118-199
1b	d3rw7c1	C:117-198

Class: Alpha and beta proteins (a/b) (23833)

Fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) (112)

Superfamily: L domain-like (93)

Family: mRNA export factor tap (5)

Protein domain: automated matches (1)

Human (Homo sapiens) [TaxId: 9606] (1)

2a	d3rw7a2	A:203-362
2b	d3rw7b_	B:
2c	d3rw7c2	C:203-362
2d	d3rw7d_	D:

(no "CATH Domain" information available for 3RW7)

(no "Pfam Domain" information available for 3RW7)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (NXF1_HUMAN | Q9UBU9)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0003729	mRNA binding	Interacting selectively and non-covalently with messenger RNA (mRNA), an intermediate molecule between DNA and protein. mRNA includes UTR and coding sequences, but does not contain introns.
	GO:0005487	nucleocytoplasmic transporter activity	Enables the directed movement of substances between the nucleus and the cytoplasm of a cell.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0003727	single-stranded RNA binding	Interacting selectively and non-covalently with single-stranded RNA.
biological process
	GO:0006405	RNA export from nucleus	The directed movement of RNA from the nucleus to the cytoplasm.
	GO:0006406	mRNA export from nucleus	The directed movement of mRNA from the nucleus to the cytoplasm.
	GO:0051028	mRNA transport	The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0016973	poly(A)+ mRNA export from nucleus	The directed movement of poly(A)+ mRNA out of the nucleus into the cytoplasm.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0042405	nuclear inclusion body	An intranuclear focus at which aggregated proteins have been sequestered.
	GO:0005643	nuclear pore	Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
	GO:0016607	nuclear speck	A discrete extra-nucleolar subnuclear domain, 20-50 in number, in which splicing factors are seen to be localized by immunofluorescence microscopy.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0000346	transcription export complex	The transcription export (TREX) complex couples transcription elongation by RNA polymerase II to mRNA export. The complex associates with the polymerase and travels with it along the length of the transcribed gene. TREX is composed of the THO transcription elongation complex as well as other proteins that couple THO to mRNA export proteins. The TREX complex is known to be found in a wide range of eukaryotes, including S. cerevisiae and metazoans.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3rw7)

	Sites
(no "Sites" information available for 3rw7)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3rw7)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3rw7
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	NXF1_HUMAN \| Q9UBU9
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	NXF1_HUMAN \| Q9UBU9
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	NXF1_HUMAN \| Q9UBU9	:	1fo1 1ft8 1go5 1jkg 1jn5 1koh 1koo 1oai 2z5k 2z5m 3rw6 4wyk

3rw6	STRUCTURE OF NUCLEAR RNA EXPORT FACTOR TAP BOUND TO CTE RNA

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 12)

Exons (10, 34)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 6)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (21, 21)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File