Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE RNA-BINDING DOMAIN OF THE MRNA EXPORT FACTOR TAP
 
Authors :  E. Liker, E. Fernandez, E. Izaurralde, E. Conti
Date :  12 Sep 00  (Deposition) - 11 Dec 00  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.15
Chains :  Asym. Unit :  A,B,C,D,E
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  E  (1x)
Keywords :  Ribonucleoprotein (Rnp, Rrm, Rbd) And Leucine-Rich-Repeat (Lrr) Domains, Rna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. Liker, E. Fernandez, E. Izaurralde, E. Conti
The Structure Of The Mrna Export Factor Tap Reveals A Cis Arrangement Of A Non-Canonical Rnp Domain And An Lrr Domain.
Embo J. V. 19 5587 2000
PubMed-ID: 11060011  |  Reference-DOI: 10.1093/EMBOJ/19.21.5587
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TIP ASSOCIATING PROTEIN
    ChainsA, B, C, D, E
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPGEX-CS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentRESIDUES 42-312
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymTAP

 Structural Features

(-) Chains, Units

  12345
Asymmetric Unit ABCDE
Biological Unit 1 (1x)A    
Biological Unit 2 (1x) B   
Biological Unit 3 (1x)  C  
Biological Unit 4 (1x)   D 
Biological Unit 5 (1x)    E

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1FT8)

(-) Sites  (0, 0)

(no "Site" information available for 1FT8)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1FT8)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1FT8)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1FT8)

(-) PROSITE Motifs  (1, 12)

Asymmetric Unit (1, 12)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LRRPS51450 Leucine-rich repeat profile.NXF1_HUMAN266-287
 
 
 
292-313
 
 
 
316-337
 
 
 
  12A:266-287
B:266-287
C:266-287
D:266-287
A:292-313
B:292-313
C:292-313
D:292-313
A:316-337
B:316-337
C:316-337
D:316-337
Biological Unit 1 (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LRRPS51450 Leucine-rich repeat profile.NXF1_HUMAN266-287
 
 
 
292-313
 
 
 
316-337
 
 
 
  3A:266-287
-
-
-
A:292-313
-
-
-
A:316-337
-
-
-
Biological Unit 2 (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LRRPS51450 Leucine-rich repeat profile.NXF1_HUMAN266-287
 
 
 
292-313
 
 
 
316-337
 
 
 
  3-
B:266-287
-
-
-
B:292-313
-
-
-
B:316-337
-
-
Biological Unit 3 (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LRRPS51450 Leucine-rich repeat profile.NXF1_HUMAN266-287
 
 
 
292-313
 
 
 
316-337
 
 
 
  3-
-
C:266-287
-
-
-
C:292-313
-
-
-
C:316-337
-
Biological Unit 4 (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LRRPS51450 Leucine-rich repeat profile.NXF1_HUMAN266-287
 
 
 
292-313
 
 
 
316-337
 
 
 
  3-
-
-
D:266-287
-
-
-
D:292-313
-
-
-
D:316-337
Biological Unit 5 (, 0)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LRRPS51450 Leucine-rich repeat profile.NXF1_HUMAN266-287
 
 
 
292-313
 
 
 
316-337
 
 
 
  0-
-
-
-
-
-
-
-
-
-
-
-

(-) Exons   (10, 37)

Asymmetric Unit (10, 37)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2bENST000002941722bENSE00001198395chr11:62572964-62572801164NXF1_HUMAN1-10100--
1.4eENST000002941724eENSE00001063544chr11:62571450-62571264187NXF1_HUMAN10-72630--
1.4gENST000002941724gENSE00001198378chr11:62571044-62570891154NXF1_HUMAN72-123523A:118-123
-
C:117-123
-
E:119-123
6
-
7
-
5
1.5bENST000002941725bENSE00001198363chr11:62569732-6256964984NXF1_HUMAN124-151283A:124-151
-
C:124-151
-
E:131-151
28
-
28
-
21
1.6cENST000002941726cENSE00001198351chr11:62569518-62569414105NXF1_HUMAN152-186353A:152-186
-
C:152-186
-
E:152-175 (gaps)
35
-
35
-
24
1.7ENST000002941727ENSE00001198338chr11:62569291-6256921181NXF1_HUMAN187-213274A:187-213 (gaps)
B:203-213
C:187-213 (gaps)
D:204-213
-
27
11
27
10
-
1.8ENST000002941728ENSE00001198325chr11:62569103-6256903470NXF1_HUMAN214-237244A:214-237
B:214-237
C:214-237
D:214-237
-
24
24
24
24
-
1.9ENST000002941729ENSE00001198312chr11:62568889-6256880189NXF1_HUMAN237-266304A:237-266
B:237-266
C:237-266
D:237-266
-
30
30
30
30
-
1.10ENST0000029417210ENSE00001198304chr11:62568673-62568566108NXF1_HUMAN267-302364A:267-302
B:267-302
C:267-302
D:267-302
-
36
36
36
36
-
1.11aENST0000029417211aENSE00001198291chr11:62567958-62567849110NXF1_HUMAN303-339374A:303-339
B:303-339
C:303-339
D:303-339
-
37
37
37
37
-
1.11gENST0000029417211gENSE00001198284chr11:62566047-6256601137NXF1_HUMAN339-351134A:339-351
B:339-351
C:339-351
D:339-351
-
13
13
13
13
-
1.12ENST0000029417212ENSE00001063548chr11:62564858-6256479069NXF1_HUMAN352-374234A:352-362
B:352-367
C:352-362
D:352-365
-
11
16
11
14
-
1.13ENST0000029417213ENSE00001063546chr11:62564710-6256465556NXF1_HUMAN375-393190--
1.15aENST0000029417215aENSE00001063554chr11:62564039-62563932108NXF1_HUMAN393-429370--
1.16bENST0000029417216bENSE00001141830chr11:62563817-6256375959NXF1_HUMAN429-449210--
1.17bENST0000029417217bENSE00001141824chr11:62563653-62563538116NXF1_HUMAN449-487390--
1.18ENST0000029417218ENSE00001141816chr11:62563415-6256337343NXF1_HUMAN488-502150--
1.19bENST0000029417219bENSE00001274696chr11:62562479-6256240773NXF1_HUMAN502-526250--
1.20cENST0000029417220cENSE00001063547chr11:62561912-62561730183NXF1_HUMAN526-587620--
1.21aENST0000029417221aENSE00001764908chr11:62560173-6256011361NXF1_HUMAN587-607210--
1.21hENST0000029417221hENSE00001198195chr11:62559986-62559598389NXF1_HUMAN608-619120--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:242
 aligned with NXF1_HUMAN | Q9UBU9 from UniProtKB/Swiss-Prot  Length:619

    Alignment length:245
                                   127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357     
           NXF1_HUMAN   118 NWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF 362
               SCOP domains d1ft8a2 A:118-199 mRNA export factor tap                                          ---d1ft8a1 A:203-362 mRNA export factor tap                                                                                                                         SCOP domains
               CATH domains ---------------------------1ft8A01 A:145-199  [code=3.30.70.330, no name defined] ---1ft8A02 A:203-362 Ribonuclease Inhibitor                                                                                                                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhhhhhhhhhhhhhhh......eeeeee..eeeeee.hhhhhhhhhh....ee.....ee..eeeee.....---..hhhhhhhhhhhhhhhee....eee..hhhhh.............hhhhhhhhhhhhhhhh....eee.......hhhhhhhhhhhh....eee........hhhhhhhh.....eee...hhhhhhh.hhhhhhhhhhhhh....ee..ee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------LRR  PDB: A:266-287   ----LRR  PDB: A:292-313   --LRR  PDB: A:316-337   ------------------------- PROSITE
           Transcript 1 (1) 1.4g  Exon 1.5b  PDB: A:124-151   Exon 1.6c  PDB: A:152-186          Exon 1.7 UniProt: 187-213  Exon 1.8  PDB: A:214-237-----------------------------Exon 1.10  PDB: A:267-302           Exon 1.11a  PDB: A:303-339           ------------Exon 1.12   Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------Exon 1.9  PDB: A:237-266      ------------------------------------------------------------------------Exon 1.11g   ----------- Transcript 1 (2)
                 1ft8 A 118 NWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHT---ELKPEQVEQLKLIMSKRYDGSQQVLDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF 362
                                   127       137       147       157       167       177       187       197 |   | 207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357     
                                                                                                           199 203                                                                                                                                                               

Chain B from PDB  Type:PROTEIN  Length:165
 aligned with NXF1_HUMAN | Q9UBU9 from UniProtKB/Swiss-Prot  Length:619

    Alignment length:165
                                   212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362     
           NXF1_HUMAN   203 ELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVEAP 367
               SCOP domains d1ft8b_ B: mRNA export factor tap                                                                                                                                     SCOP domains
               CATH domains 1ft8B00 B:203-367 Ribonuclease Inhibitor                                                                                                                              CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhee....eee..hhhhhhhhhhh.......hhhhhhhhhhhhhhhh....eee.......hhhhhhhhhhhh....eee.......hhhhhhhhh.....eee...hhhhhhh.hhhhhhhhhhh......ee..ee............ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------LRR  PDB: B:266-287   ----LRR  PDB: B:292-313   --LRR  PDB: B:316-337   ------------------------------ PROSITE
           Transcript 1 (1) Exon 1.7   Exon 1.8  PDB: B:214-237-----------------------------Exon 1.10  PDB: B:267-302           Exon 1.11a  PDB: B:303-339           ------------Exon 1.12        Transcript 1 (1)
           Transcript 1 (2) ----------------------------------Exon 1.9  PDB: B:237-266      ------------------------------------------------------------------------Exon 1.11g   ---------------- Transcript 1 (2)
                 1ft8 B 203 ELKPEQVEQLKLIMSKRYDGSQQVLDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVEAP 367
                                   212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362     

Chain C from PDB  Type:PROTEIN  Length:244
 aligned with NXF1_HUMAN | Q9UBU9 from UniProtKB/Swiss-Prot  Length:619

    Alignment length:246
                                   126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356      
           NXF1_HUMAN   117 KNWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF 362
               SCOP domains d1ft8c2 C:117-198 mRNA export factor tap                                          --d1ft8c1 C:201-362 mRNA export factor tap                                                                                                                           SCOP domains
               CATH domains -----------------------------1ft8C01 C:146-202  [code=3.30.70.330, no name defined  ] 1ft8C02 C:203-362 Ribonuclease Inhibitor                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeee.hhhhhhhhhhhhhhhhhh......eeeeee..eeeeee.hhhhhhhhhh....ee.....ee..eeeee....--....hhhhhhhhhhhhhh.ee....eee......hhhhhhhh......hhhhhhhhhhhhhhhh....eee.......hhhhhhhhhhhh....eee........hhhhhhhh.....eee...hhhhhhh.hhhhhhhhhhhhh....ee..ee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------LRR  PDB: C:266-287   ----LRR  PDB: C:292-313   --LRR  PDB: C:316-337   ------------------------- PROSITE
           Transcript 1 (1) 1.4g   Exon 1.5b  PDB: C:124-151   Exon 1.6c  PDB: C:152-186          Exon 1.7 UniProt: 187-213  Exon 1.8  PDB: C:214-237-----------------------------Exon 1.10  PDB: C:267-302           Exon 1.11a  PDB: C:303-339           ------------Exon 1.12   Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------Exon 1.9  PDB: C:237-266      ------------------------------------------------------------------------Exon 1.11g   ----------- Transcript 1 (2)
                 1ft8 C 117 KNWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPH--LNELKPEQVEQLKLIMSKRYDGSQQVLDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF 362
                                   126       136       146       156       166       176       186       196 |  |  206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356      
                                                                                                           198  |                                                                                                                                                                 
                                                                                                              201                                                                                                                                                                 

Chain D from PDB  Type:PROTEIN  Length:162
 aligned with NXF1_HUMAN | Q9UBU9 from UniProtKB/Swiss-Prot  Length:619

    Alignment length:162
                                   213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363  
           NXF1_HUMAN   204 LKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVE 365
               SCOP domains d1ft8d_ D: mRNA export factor tap                                                                                                                                  SCOP domains
               CATH domains 1ft8D00 D:204-365 Ribonuclease Inhibitor                                                                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh.ee....eee........hhhhh.......hhhhhhhhhhhhhhhh....eee.......hhhhhhhhhhhh....eee.......hhhhhhhhh.....eee...hhhhhhh.hhhhhhhhhhhhh....ee..ee.......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------LRR  PDB: D:266-287   ----LRR  PDB: D:292-313   --LRR  PDB: D:316-337   ---------------------------- PROSITE
           Transcript 1 (1) Exon 1.7  Exon 1.8  PDB: D:214-237-----------------------------Exon 1.10  PDB: D:267-302           Exon 1.11a  PDB: D:303-339           ------------Exon 1.12      Transcript 1 (1)
           Transcript 1 (2) ---------------------------------Exon 1.9  PDB: D:237-266      ------------------------------------------------------------------------Exon 1.11g   -------------- Transcript 1 (2)
                 1ft8 D 204 LKPEQVEQLKLIMSKRYDGSQQVLDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVE 365
                                   213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363  

Chain E from PDB  Type:PROTEIN  Length:44
 aligned with NXF1_HUMAN | Q9UBU9 from UniProtKB/Swiss-Prot  Length:619

    Alignment length:57
                                   128       138       148       158       168       
           NXF1_HUMAN   119 WFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAV 175
               SCOP domains d1ft8       e_ E: mRNA export facto      r tap            SCOP domains
               CATH domains 1ft8E       00 E:119-175  [code=3.3      0.70.330, no nam CATH domains
               Pfam domains --------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.-------hhhhhhhhhhhhh..........------.eee.hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.4g Exon 1.5b  PDB: E:131-151   Exon 1.6c [INCOMPLETE]   Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------- Transcript 1 (2)
                 1ft8 E 119 WFKIT-------DKAWLLSMIQSKCSVPFTPIEFH------QFFVEDASTASALKAV 175
                                |    -  |    138       148    |    - |     168       
                              123     131                   153    160               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 7)

Asymmetric Unit

(-) CATH Domains  (2, 7)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1FT8)

(-) Gene Ontology  (21, 21)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E   (NXF1_HUMAN | Q9UBU9)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0003729    mRNA binding    Interacting selectively and non-covalently with messenger RNA (mRNA), an intermediate molecule between DNA and protein. mRNA includes UTR and coding sequences, but does not contain introns.
    GO:0005487    nucleocytoplasmic transporter activity    Enables the directed movement of substances between the nucleus and the cytoplasm of a cell.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003727    single-stranded RNA binding    Interacting selectively and non-covalently with single-stranded RNA.
biological process
    GO:0006405    RNA export from nucleus    The directed movement of RNA from the nucleus to the cytoplasm.
    GO:0006406    mRNA export from nucleus    The directed movement of mRNA from the nucleus to the cytoplasm.
    GO:0051028    mRNA transport    The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0016973    poly(A)+ mRNA export from nucleus    The directed movement of poly(A)+ mRNA out of the nucleus into the cytoplasm.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0042405    nuclear inclusion body    An intranuclear focus at which aggregated proteins have been sequestered.
    GO:0005643    nuclear pore    Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
    GO:0016607    nuclear speck    A discrete extra-nucleolar subnuclear domain, 20-50 in number, in which splicing factors are seen to be localized by immunofluorescence microscopy.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000346    transcription export complex    The transcription export (TREX) complex couples transcription elongation by RNA polymerase II to mRNA export. The complex associates with the polymerase and travels with it along the length of the transcribed gene. TREX is composed of the THO transcription elongation complex as well as other proteins that couple THO to mRNA export proteins. The TREX complex is known to be found in a wide range of eukaryotes, including S. cerevisiae and metazoans.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ft8)
 
  Sites
(no "Sites" information available for 1ft8)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ft8)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ft8
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NXF1_HUMAN | Q9UBU9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  NXF1_HUMAN | Q9UBU9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NXF1_HUMAN | Q9UBU91fo1 1go5 1jkg 1jn5 1koh 1koo 1oai 2z5k 2z5m 3rw6 3rw7 4wyk

(-) Related Entries Specified in the PDB File

1fo1 CRYSTAL STRUCTURE OF THE RNA-BINDING DOMAIN OF THE MRNA EXPORT FACTOR TAP