3R93 - JenaLib

Asymmetric Unit (3, 12)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HISTONE_H3_1	PS00322	Histone H3 signature 1.	H32_HUMAN	15-21	4	E:14-15 F:14-15 G:14-15 H:14-15
2	CHROMO_2	PS50013	Chromo and chromo shadow domain profile.	MPP8_HUMAN	59-109	4	A:59-109 B:59-109 C:59-109 D:59-109
3	CHROMO_1	PS00598	Chromo domain signature.	MPP8_HUMAN	76-96	4	A:76-96 B:76-96 C:76-96 D:76-96

Biological Unit 1 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HISTONE_H3_1	PS00322	Histone H3 signature 1.	H32_HUMAN	15-21	1	E:14-15 - - -
2	CHROMO_2	PS50013	Chromo and chromo shadow domain profile.	MPP8_HUMAN	59-109	1	A:59-109 - - -
3	CHROMO_1	PS00598	Chromo domain signature.	MPP8_HUMAN	76-96	1	A:76-96 - - -

Biological Unit 2 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HISTONE_H3_1	PS00322	Histone H3 signature 1.	H32_HUMAN	15-21	1	- F:14-15 - -
2	CHROMO_2	PS50013	Chromo and chromo shadow domain profile.	MPP8_HUMAN	59-109	1	- B:59-109 - -
3	CHROMO_1	PS00598	Chromo domain signature.	MPP8_HUMAN	76-96	1	- B:76-96 - -

Biological Unit 3 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HISTONE_H3_1	PS00322	Histone H3 signature 1.	H32_HUMAN	15-21	1	- - G:14-15 -
2	CHROMO_2	PS50013	Chromo and chromo shadow domain profile.	MPP8_HUMAN	59-109	1	- - C:59-109 -
3	CHROMO_1	PS00598	Chromo domain signature.	MPP8_HUMAN	76-96	1	- - C:76-96 -

Biological Unit 4 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HISTONE_H3_1	PS00322	Histone H3 signature 1.	H32_HUMAN	15-21	1	- - - H:14-15
2	CHROMO_2	PS50013	Chromo and chromo shadow domain profile.	MPP8_HUMAN	59-109	1	- - - D:59-109
3	CHROMO_1	PS00598	Chromo domain signature.	MPP8_HUMAN	76-96	1	- - - D:76-96

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:58
 aligned with MPP8_HUMAN | Q99549 from UniProtKB/Swiss-Prot  Length:860

    Alignment length:58
                                    66        76        86        96       106        
           MPP8_HUMAN    57 DVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENK 114
               SCOP domains d3r93a_ A: automated matches                               SCOP domains
               CATH domains ---------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeeeee..eeeeeeee...hhhh.eeee.hhhh.hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --CHROMO_2  PDB: A:59-109 UniProt: 59-109            ----- PROSITE (1)
                PROSITE (2) -------------------CHROMO_1  PDB: A:76-9------------------ PROSITE (2)
                 Transcript ---------------------------------------------------------- Transcript
                 3r93 A  57 DVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENK 114
                                    66        76        86        96       106

Chain B from PDB  Type:PROTEIN  Length:58
 aligned with MPP8_HUMAN | Q99549 from UniProtKB/Swiss-Prot  Length:860

    Alignment length:58
                                    66        76        86        96       106        
           MPP8_HUMAN    57 DVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENK 114
               SCOP domains d3r93b_ B: automated matches                               SCOP domains
               CATH domains ---------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeeeee..eeeeeeee...hhhhheeee.hhh..hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --CHROMO_2  PDB: B:59-109 UniProt: 59-109            ----- PROSITE (1)
                PROSITE (2) -------------------CHROMO_1  PDB: B:76-9------------------ PROSITE (2)
                 Transcript ---------------------------------------------------------- Transcript
                 3r93 B  57 DVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENK 114
                                    66        76        86        96       106

Chain C from PDB  Type:PROTEIN  Length:58
 aligned with MPP8_HUMAN | Q99549 from UniProtKB/Swiss-Prot  Length:860

    Alignment length:58
                                    66        76        86        96       106        
           MPP8_HUMAN    57 DVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENK 114
               SCOP domains d3r93c_ C: automated matches                               SCOP domains
               CATH domains ---------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeeeee..eeeeeeee...hhhhheeee.hhhh.hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --CHROMO_2  PDB: C:59-109 UniProt: 59-109            ----- PROSITE (1)
                PROSITE (2) -------------------CHROMO_1  PDB: C:76-9------------------ PROSITE (2)
                 Transcript ---------------------------------------------------------- Transcript
                 3r93 C  57 DVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENK 114
                                    66        76        86        96       106

Chain D from PDB  Type:PROTEIN  Length:59
 aligned with MPP8_HUMAN | Q99549 from UniProtKB/Swiss-Prot  Length:860

    Alignment length:59
                                    65        75        85        95       105         
           MPP8_HUMAN    56 EDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENK 114
               SCOP domains d3r93d_ D: automated matches                                SCOP domains
               CATH domains ----------------------------------------------------------- CATH domains
           Pfam domains (1) ---Chromo-3r93D01 D:59-109                            ----- Pfam domains (1)
           Pfam domains (2) ---Chromo-3r93D02 D:59-109                            ----- Pfam domains (2)
           Pfam domains (3) ---Chromo-3r93D03 D:59-109                            ----- Pfam domains (3)
           Pfam domains (4) ---Chromo-3r93D04 D:59-109                            ----- Pfam domains (4)
         Sec.struct. author ..eeeeeeeeeeeee..eeeeeeee...hhhh.eeee.hhhh.hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---CHROMO_2  PDB: D:59-109 UniProt: 59-109            ----- PROSITE (1)
                PROSITE (2) --------------------CHROMO_1  PDB: D:76-9------------------ PROSITE (2)
                 Transcript ----------------------------------------------------------- Transcript
                 3r93 D  56 EDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENK 114
                                    65        75        85        95       105

Chain E from PDB  Type:PROTEIN  Length:12
 aligned with H32_HUMAN | Q71DI3 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:12
                                    14  
            H32_HUMAN     5 KQTARKSTGGKA  16
               SCOP domains ------------ SCOP domains
               CATH domains ------------ CATH domains
               Pfam domains ------------ Pfam domains
         Sec.struct. author ..eee....ee. Sec.struct. author
                 SAPs(SNPs) ------------ SAPs(SNPs)
                    PROSITE ----------HI PROSITE
                 Transcript ------------ Transcript
                 3r93 E   4 KQTARkSTGGKA  15
                                 |  13  
                                 9-M3L

Chain F from PDB  Type:PROTEIN  Length:14
 aligned with H32_HUMAN | Q71DI3 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:14
                                    12    
            H32_HUMAN     3 RTKQTARKSTGGKA  16
               SCOP domains -------------- SCOP domains
               CATH domains -------------- CATH domains
               Pfam domains -------------- Pfam domains
         Sec.struct. author ....eee....... Sec.struct. author
                 SAPs(SNPs) -------------- SAPs(SNPs)
                    PROSITE ------------HI PROSITE
                 Transcript -------------- Transcript
                 3r93 F   2 RTKQTARkSTGGKA  15
                                   |11    
                                   9-M3L

Chain G from PDB  Type:PROTEIN  Length:12
 aligned with H32_HUMAN | Q71DI3 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:12
                                    14  
            H32_HUMAN     5 KQTARKSTGGKA  16
               SCOP domains ------------ SCOP domains
               CATH domains ------------ CATH domains
               Pfam domains ------------ Pfam domains
         Sec.struct. author ..eee....... Sec.struct. author
                 SAPs(SNPs) ------------ SAPs(SNPs)
                    PROSITE ----------HI PROSITE
                 Transcript ------------ Transcript
                 3r93 G   4 KQTARkSTGGKA  15
                                 |  13  
                                 9-M3L

Chain H from PDB  Type:PROTEIN  Length:12
 aligned with H32_HUMAN | Q71DI3 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:12
                                    14  
            H32_HUMAN     5 KQTARKSTGGKA  16
               SCOP domains ------------ SCOP domains
               CATH domains ------------ CATH domains
               Pfam domains ------------ Pfam domains
         Sec.struct. author ..eee....ee. Sec.struct. author
                 SAPs(SNPs) ------------ SAPs(SNPs)
                    PROSITE ----------HI PROSITE
                 Transcript ------------ Transcript
                 3r93 H   4 KQTARkSTGGKA  15
                                 |  13  
                                 9-M3L

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (0, 0)

Pfam Domains (1, 4)

Gene Ontology (27, 31)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (MPP8_HUMAN | Q99549)

molecular function
	GO:0035064	methylated histone binding	Interacting selectively and non-covalently with a histone in which a residue has been modified by methylation. Histones are any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0044030	regulation of DNA methylation	Any process that modulates the frequency, rate or extent of the covalent transfer of a methyl group to either N-6 of adenine or C-5 or N-4 of cytosine.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005694	chromosome	A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005720	nuclear heterochromatin	A condensed form of chromatin, occurring in the nucleus during interphase, that stains strongly with basophilic dyes. The DNA of heterochromatin is typically replicated at a later stage in the cell-division cycle than euchromatin.
	GO:0000788	nuclear nucleosome	A complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA in the nucleus into higher order structures.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain E,F,G,H (H32_HUMAN | Q71DI3)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0042393	histone binding	Interacting selectively and non-covalently with a histone, any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes. They are involved in the condensation and coiling of chromosomes during cell division and have also been implicated in nonspecific suppression of gene activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
biological process
	GO:0007596	blood coagulation	The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
	GO:0044267	cellular protein metabolic process	The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
	GO:0000183	chromatin silencing at rDNA	Repression of transcription of ribosomal DNA by altering the structure of chromatin.
	GO:0031047	gene silencing by RNA	Any process in which RNA molecules inactivate expression of target genes.
	GO:0045814	negative regulation of gene expression, epigenetic	Any epigenetic process that stops, prevents or reduces the rate of gene expression.
	GO:0006334	nucleosome assembly	The aggregation, arrangement and bonding together of a nucleosome, the beadlike structural units of eukaryotic chromatin composed of histones and DNA.
	GO:0045815	positive regulation of gene expression, epigenetic	Any epigenetic process that activates or increases the rate of gene expression.
cellular component
	GO:0005694	chromosome	A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0000786	nucleosome	A complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA into higher order structures.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	3r93
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	H32_HUMAN \| Q71DI3
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	MPP8_HUMAN \| Q99549
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 7)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 12)