3SVM - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   HUMAN MPP8 - HUMAN DNMT3AK47ME2 PEPTIDE

Authors :   Y. Chang, J. R. Horton, X. Zhang, X. Cheng

Date :   12 Jul 11 (Deposition) - 30 Nov 11 (Release) - 30 Nov 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.31

Chains :   Asym. Unit : A,P
Biol. Unit 1: A,P  (1x)
Biol. Unit 2: A,P  (2x)

Keywords :   Epigenetics, Methyl-Lysine Binding, Chromodomain, The Dimethylated Human Dnmt3Ak47Me2 Is Recognized By The Chromodomain Of Mpp8, Mpp8 Chromodomain, Dimethylated Lysine, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Chang, L. Sun, K. Kokura, J. R. Horton, M. Fukuda, A. Espejo, V. Izumi J. M. Koomen, M. T. Bedford, X. Zhang, Y. Shinkai, J. Fang, X. Cheng
Mpp8 Mediates The Interactions Between Dna Methyltransferas Dnmt3A And H3K9 Methyltransferase Glp/G9A.
Nat Commun V. 2 533 2011
PubMed-ID: 22086334 | Reference-DOI: 10.1038/NCOMMS1549

Molecule 1 - M-PHASE PHOSPHOPROTEIN 8
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PXC941
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 55-116
	Gene	:	MPHOSPH8, MPP8
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TWO HYBRID-ASSOCIATED PROTEIN 3 WITH RANBPM, TWA3

Molecule 2 - DNA (CYTOSINE-5)-METHYLTRANSFERASE 3A
	Chains	:	P
	EC Number	:	2.1.1.37
	Engineered	:	YES
	Fragment	:	UNP RESIDUES 40-53
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	DNMT3A, DNA METHYLTRANSFERASE HSAIIIA, DNA MTASE HSAIIIA, M.HSAIIIA
	Synthetic	:	YES

		1	2
Asymmetric Unit	:	A	P
Biological Unit 1 (1x)	:	A	P
Biological Unit 2 (2x)	:	A	P

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 1)

No.	Name	Count	Type	Full Name
1	MLY	1	Mod. Amino Acid	N-DIMETHYL-LYSINE

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	MLY	1	Mod. Amino Acid	N-DIMETHYL-LYSINE

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	MLY	2	Mod. Amino Acid	N-DIMETHYL-LYSINE

(no "Site" information available for 3SVM)

(no "SS Bond" information available for 3SVM)

(no "Cis Peptide Bond" information available for 3SVM)

(no "SAP(SNP)/Variant" information available for 3SVM)

Asymmetric Unit (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CHROMO_2	PS50013	Chromo and chromo shadow domain profile.	MPP8_HUMAN	59-109	1	A:59-109
2	CHROMO_1	PS00598	Chromo domain signature.	MPP8_HUMAN	76-96	1	A:76-96

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CHROMO_2	PS50013	Chromo and chromo shadow domain profile.	MPP8_HUMAN	59-109	1	A:59-109
2	CHROMO_1	PS00598	Chromo domain signature.	MPP8_HUMAN	76-96	1	A:76-96

Biological Unit 2 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CHROMO_2	PS50013	Chromo and chromo shadow domain profile.	MPP8_HUMAN	59-109	2	A:59-109
2	CHROMO_1	PS00598	Chromo domain signature.	MPP8_HUMAN	76-96	2	A:76-96

Asymmetric Unit (1, 1)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2	ENST00000321117	2	ENSE00001522911	chr2:25564754-25564695	60	DNM3A_HUMAN	-	0	0	-	-
1.3	ENST00000321117	3	ENSE00001408175	chr2:25537030-25536782	249	DNM3A_HUMAN	1-24	24	0	-	-
1.4	ENST00000321117	4	ENSE00000808934	chr2:25523112-25523008	105	DNM3A_HUMAN	25-59	35	1	P:39-50	12
1.5a	ENST00000321117	5a	ENSE00001326003	chr2:25505580-25505310	271	DNM3A_HUMAN	60-150	91	0	-	-
1.6	ENST00000321117	6	ENSE00001486208	chr2:25498412-25498369	44	DNM3A_HUMAN	150-164	15	0	-	-
1.7	ENST00000321117	7	ENSE00000808931	chr2:25497956-25497810	147	DNM3A_HUMAN	165-213	49	0	-	-
1.11	ENST00000321117	11	ENSE00001739049	chr2:25471121-25470906	216	DNM3A_HUMAN	214-285	72	0	-	-
1.12b	ENST00000321117	12b	ENSE00001281470	chr2:25470618-25470460	159	DNM3A_HUMAN	286-338	53	0	-	-
1.13b	ENST00000321117	13b	ENSE00001071033	chr2:25470027-25469920	108	DNM3A_HUMAN	339-374	36	0	-	-
1.14c	ENST00000321117	14c	ENSE00001281455	chr2:25469645-25469489	157	DNM3A_HUMAN	375-427	53	0	-	-
1.15a	ENST00000321117	15a	ENSE00001071035	chr2:25469178-25469029	150	DNM3A_HUMAN	427-477	51	0	-	-
1.16	ENST00000321117	16	ENSE00001281442	chr2:25468933-25468889	45	DNM3A_HUMAN	477-492	16	0	-	-
1.17b	ENST00000321117	17b	ENSE00001071029	chr2:25468201-25468122	80	DNM3A_HUMAN	492-518	27	0	-	-
1.18	ENST00000321117	18	ENSE00001071031	chr2:25467521-25467409	113	DNM3A_HUMAN	519-556	38	0	-	-
1.19b	ENST00000321117	19b	ENSE00001281418	chr2:25467207-25467024	184	DNM3A_HUMAN	556-617	62	0	-	-
1.20a	ENST00000321117	20a	ENSE00001281558	chr2:25466851-25466767	85	DNM3A_HUMAN	618-646	29	0	-	-
1.21c	ENST00000321117	21c	ENSE00001071020	chr2:25464576-25464431	146	DNM3A_HUMAN	646-694	49	0	-	-
1.22	ENST00000321117	22	ENSE00001071021	chr2:25463599-25463509	91	DNM3A_HUMAN	695-725	31	0	-	-
1.23	ENST00000321117	23	ENSE00001726066	chr2:25463319-25463171	149	DNM3A_HUMAN	725-774	50	0	-	-
1.25b	ENST00000321117	25b	ENSE00001622127	chr2:25462084-25461999	86	DNM3A_HUMAN	775-803	29	0	-	-
1.26b	ENST00000321117	26b	ENSE00001679782	chr2:25459874-25459805	70	DNM3A_HUMAN	803-826	24	0	-	-
1.27b	ENST00000321117	27b	ENSE00001765738	chr2:25458694-25458576	119	DNM3A_HUMAN	827-866	40	0	-	-
1.28c	ENST00000321117	28c	ENSE00001761921	chr2:25457289-25455845	1445	DNM3A_HUMAN	866-912	47	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:60
 aligned with MPP8_HUMAN | Q99549 from UniProtKB/Swiss-Prot  Length:860

    Alignment length:60
                                    65        75        85        95       105       115
           MPP8_HUMAN    56 EDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKA 115
               SCOP domains d3svma_ A: automated matches                                 SCOP domains
               CATH domains ------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeeeeeeeeee..eeeeeeee...hhhhheeee.hhh..hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---CHROMO_2  PDB: A:59-109 UniProt: 59-109            ------ PROSITE (1)
                PROSITE (2) --------------------CHROMO_1  PDB: A:76-9------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------ Transcript
                 3svm A  56 EDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKA 115
                                    65        75        85        95       105       115

Chain P from PDB  Type:PROTEIN  Length:12
 aligned with DNM3A_HUMAN | Q9Y6K1 from UniProtKB/Swiss-Prot  Length:912

    Alignment length:12
                                    48  
          DNM3A_HUMAN    39 QEPSTTARKVGR  50
               SCOP domains ------------ SCOP domains
               CATH domains ------------ CATH domains
               Pfam domains ------------ Pfam domains
         Sec.struct. author .....ee..... Sec.struct. author
                 SAPs(SNPs) ------------ SAPs(SNPs)
                    PROSITE ------------ PROSITE
               Transcript 1 Exon 1.4     Transcript 1
                 3svm P  39 YEPSTTARkVGR  50
                                    48  
                                   47-MLY

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: SH3-like barrel (1035)

Superfamily: Chromo domain-like (82)

Family: automated matches (10)

Protein domain: automated matches (10)

Human (Homo sapiens) [TaxId: 9606] (7)

d3svma_

(no "CATH Domain" information available for 3SVM)

(no "Pfam Domain" information available for 3SVM)

Asymmetric Unit(hide GO term definitions)

Chain A (MPP8_HUMAN | Q99549)

molecular function
	GO:0035064	methylated histone binding	Interacting selectively and non-covalently with a histone in which a residue has been modified by methylation. Histones are any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0044030	regulation of DNA methylation	Any process that modulates the frequency, rate or extent of the covalent transfer of a methyl group to either N-6 of adenine or C-5 or N-4 of cytosine.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005694	chromosome	A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005720	nuclear heterochromatin	A condensed form of chromatin, occurring in the nucleus during interphase, that stains strongly with basophilic dyes. The DNA of heterochromatin is typically replicated at a later stage in the cell-division cycle than euchromatin.
	GO:0000788	nuclear nucleosome	A complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA in the nucleus into higher order structures.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain P (DNM3A_HUMAN | Q9Y6K1)

molecular function
	GO:0003886	DNA (cytosine-5-)-methyltransferase activity	Catalysis of the reaction: S-adenosyl-L-methionine + DNA containing cytosine = S-adenosyl-L-homocysteine + DNA containing 5-methylcytosine.
	GO:0051718	DNA (cytosine-5-)-methyltransferase activity, acting on CpG substrates	Catalysis of the reaction: S-adenosyl-L-methionine + CpG (in DNA) = S-adenosyl-L-homocysteine + 5-MeCpG (in DNA).
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0009008	DNA-methyltransferase activity	Catalysis of the transfer of a methyl group to a DNA molecule.
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0008168	methyltransferase activity	Catalysis of the transfer of a methyl group to an acceptor molecule.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0045322	unmethylated CpG binding	Interacting selectively and non-covalently with unmethylated CpG motifs. Unmethylated CpG dinucleotides are often associated with gene promoters.
biological process
	GO:0090116	C-5 methylation of cytosine	The covalent transfer of a methyl group to C-5 of cytosine in a DNA molecule.
	GO:0006306	DNA methylation	The covalent transfer of a methyl group to either N-6 of adenine or C-5 or N-4 of cytosine.
	GO:0043045	DNA methylation involved in embryo development	The covalent transfer of a methyl group to C-5 of cytosine that contributes to the epigenetic regulation of embryonic gene expression.
	GO:0043046	DNA methylation involved in gamete generation	The covalent transfer of a methyl group to C-5 of cytosine that contributes to the establishment of DNA methylation patterns in the gamete.
	GO:0032776	DNA methylation on cytosine	The covalent transfer of a methyl group to C-5 or N-4 of cytosine in a DNA molecule.
	GO:0010424	DNA methylation on cytosine within a CG sequence	The covalent transfer of a methyl group to C-5 or N-4 of a cytosine located within a CG sequence in a DNA molecule.
	GO:0046498	S-adenosylhomocysteine metabolic process	The chemical reactions and pathways involving S-adenosylhomocysteine; the L-enantiomer is formed from S-adenosylmethionine and is a strong inhibitor of S-adenosylmethionine-mediated methylation reactions. It can be cleaved to form adenosine and homocysteine.
	GO:0046499	S-adenosylmethioninamine metabolic process	The chemical reactions and pathways involving S-adenosylmethioninamine, (5-deoxy-5-adenosyl)(3-aminopropyl) methylsulfonium salt.
	GO:0007568	aging	A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
	GO:0071230	cellular response to amino acid stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amino acid stimulus. An amino acid is a carboxylic acids containing one or more amino groups.
	GO:0071361	cellular response to ethanol	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
	GO:0071456	cellular response to hypoxia	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
	GO:0097284	hepatocyte apoptotic process	Any apoptotic process in a hepatocyte, the main structural component of the liver.
	GO:0044027	hypermethylation of CpG island	An increase in the epigenetic methylation of cytosine and adenosine residues in a CpG island in DNA. CpG islands are genomic regions that contain a high frequency of the CG dinucleotide and are often associated with the transcription start site of genes.
	GO:0032259	methylation	The process in which a methyl group is covalently attached to a molecule.
	GO:0006346	methylation-dependent chromatin silencing	Repression of transcription by methylation of DNA, leading to the formation of heterochromatin.
	GO:0000278	mitotic cell cycle	Progression through the phases of the mitotic cell cycle, the most common eukaryotic cell cycle, which canonically comprises four successive phases called G1, S, G2, and M and includes replication of the genome and the subsequent segregation of chromosomes into daughter cells. In some variant cell cycles nuclear replication or nuclear division may not be followed by cell division, or G1 and G2 phases may be absent.
	GO:0045814	negative regulation of gene expression, epigenetic	Any epigenetic process that stops, prevents or reduces the rate of gene expression.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0030182	neuron differentiation	The process in which a relatively unspecialized cell acquires specialized features of a neuron.
	GO:0010942	positive regulation of cell death	Any process that increases the rate or frequency of cell death. Cell death is the specific activation or halting of processes within a cell so that its vital functions markedly cease, rather than simply deteriorating gradually over time, which culminates in cell death.
	GO:0010468	regulation of gene expression	Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0006349	regulation of gene expression by genetic imprinting	Heritable alterations in the activity of a gene that depend on whether it passed through the paternal or the maternal germline, but that are not encoded by DNA itself.
	GO:0036276	response to antidepressant	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antidepressant stimulus, a mood-stimulating drug.
	GO:0042220	response to cocaine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cocaine stimulus. Cocaine is a crystalline alkaloid obtained from the leaves of the coca plant.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0032355	response to estradiol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
	GO:0045471	response to ethanol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
	GO:0010212	response to ionizing radiation	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a ionizing radiation stimulus. Ionizing radiation is radiation with sufficient energy to remove electrons from atoms and may arise from spontaneous decay of unstable isotopes, resulting in alpha and beta particles and gamma rays. Ionizing radiation also includes X-rays.
	GO:0010288	response to lead ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lead ion stimulus.
	GO:0031667	response to nutrient levels	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus reflecting the presence, absence, or concentration of nutrients.
	GO:0009636	response to toxic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a toxic stimulus.
	GO:0033189	response to vitamin A	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a vitamin A stimulus.
	GO:0007283	spermatogenesis	The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
cellular component
	GO:0001741	XY body	A structure found in a male mammalian spermatocyte containing an unpaired X chromosome that has become densely heterochromatic, silenced and localized at the nuclear periphery.
	GO:0000775	chromosome, centromeric region	The region of a chromosome that includes the centromeric DNA and associated proteins. In monocentric chromosomes, this region corresponds to a single area of the chromosome, whereas in holocentric chromosomes, it is evenly distributed along the chromosome.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0000791	euchromatin	A dispersed and relatively uncompacted form of chromatin.
	GO:0000792	heterochromatin	A compact and highly condensed form of chromatin.
	GO:0005720	nuclear heterochromatin	A condensed form of chromatin, occurring in the nucleus during interphase, that stains strongly with basophilic dyes. The DNA of heterochromatin is typically replicated at a later stage in the cell-division cycle than euchromatin.
	GO:0016363	nuclear matrix	The dense fibrillar network lying on the inner side of the nuclear membrane.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MLY	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 3svm)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3svm)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3svm
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	DNM3A_HUMAN \| Q9Y6K1
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	MPP8_HUMAN \| Q99549
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.1.1.37
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	DNM3A_HUMAN \| Q9Y6K1
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	MPP8_HUMAN \| Q99549
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	DNM3A_HUMAN \| Q9Y6K1	:	2qrv 3a1a 3a1b 3llr 4qbq 4qbr 4qbs 4u7p 4u7t
	MPP8_HUMAN \| Q99549	:	3lwe 3qo2 3r93

3qo2	MPP8-H3K9ME2 PEPTIDE
3sw9
3swc

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 2)

Exons (1, 1)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (64, 68)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File